Property Summary

NCBI Gene PubMed Count 183
PubMed Score 2680.58
PubTator Score 2042.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
fibroadenoma -1.200 3.7e-03

Gene RIF (163)

PMID Text
26884853 CD30 may be useful as a prognostic marker in rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone (R-CHOP) treated DLBCLs, indicating favorable outcomes in a Chinese population.
26709646 this review is focused on the role of CD30 receptor and p53 as novel targets for therapy in ALK+ ALCL, and also provides an update on their potential involvement in ALK+ ALCL pathogenesis
26574847 Most angioimmunoblastic T-cell lymphoma and peripheral T-cell lymphoma-not otherwise specified express variable levels of CD30.
26371781 Intralymphatic variant of ALCL and LyP may be explained, at least in part, by a particular lymphotropism of the neoplastic cells of cutaneous CD30 lymphoproliferative disorders.
26273636 Our results demonstrated significantly elevated sCD30 levels in AS patients compared to healthy controls (HCs) with mean values of 32.0 +/- 12.2 and 24.9 +/- 8.0 ng/mL, (P(**) = 0.007), suggesting a p role of sCD30 in the pathogenesis of AS.
26261484 Upregulated expression of CD30 is commonly found in sclerosing angiomatoid nodular transformation of the spleen.
25840583 Data indicate that CD30 antigen downregulation and P-Glycoprotein (MDR1) upregulation are associated with drug resistance to brentuximab vedotin.
25698648 These results show that high sCD30 levels are independent predictors of graft dysfunction
25568342 Single threonine residue at position 61 in CD30v that is critical for TRAF2 interaction, NFkappaB activation, and downstream CD30-NFkappaB-dependent phenotypes in hESCs was identified.
25567136 Elevated serum sCD30 is associated with increased risk of non-Hodgkin lymphoma.
25548993 Case Report: suggest Sezary syndrome, CD30 anaplastic large-cell lymphoma, and mycosis fungioides are interrelated.
25492095 levels of serum sCD30 tend to be higher in individuals with atopy. Improvement in lung function seems to be associated with a decrease in sCD30 in children with atopy and troublesome lung symptoms.
25349176 Data indicate a chimeric fusion involving nucleophosmin NPM1 (5q35) and TYK2 kinase (19p13) that encodes an NPM1-TYK2 protein in cutaneous CD30 antigen-positve lymphoproliferative disorders.
25288491 Data susggest that CD30 antigen may be useful as a prognostic factor and therapeutic target in extranodal natural killer/T-cell lymphoma (NKTCL).
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tumor necrosis factor receptor superfamily, member 8 (TNFRSF8, CD30)
25248878 With the introduction of the immunoconjugate brentuximab vedotin, the CD30 antigen has become an effectively targetable molecule. Therefore, we investigated the frequency and level of CD30 expression in post-transplant lymphoproliferative disorders.
25145835 findings uncover the oncogenic role of the JUNB/CD30 axis and its potential as therapeutic target in ALK+ ALCL.
25135752 is expressed in a substantial proportion of DLBCL and CD30 immunohistochemistry may be a useful prognostic marker in R-CHOP treated GCB-DLBCL.
24805854 Suggest intralymphatic cutaneous anaplastic large cell lymphoma/lymphomatoid papulosis are part of an expanding spectrum of CD30-positive lymphoproliferative disorders.
24805132 occurs in a significant subset of angiosarcomas and epithelioid hemangioendotheliomas
24747435 this study highlights a novel SATB1-p21 axis that plays an important role in the disease progression of cutaneous CD30+LPDs, which provides novel molecular insights into this disease and possibly leads to new therapies in the future.
24745678 The expression of CD30 by mastocytosis mast cells may influence the clinical phenotype and management of mastocytosis. (Review)
24733422 case Report: primary cutaneous CD30+ anaplastic large cell lymphoma treated successfully with brentuximab vedotin.
24733405 Case Report: describe a CD30+ lymphoproliferative rash exhibiting a predilection for recurrence on the same skin sites.
24659185 Malignant Hodgkin and Reed-Sternberg cells release CD30 on the surface of extracellular vesicles facilitating CD30-CD30L interaction between cell types.
24492285 BAG-3 expression correlated with increased HSP70 expression in a subset of systemic T cell lymphoma cases co-expressing the CD30 antigen.
24375064 higher serum levels in Ewing sarcoma patients with primary bone tumors
24111625 diagnostic and prognostic value of CD30 expression in systemic mastocytosis as assessed by multiparameter flow cytometry
23937105 a substantial subset of patients with T-ALL have lymphoblasts that express surface CD30. CD30 expression by T-lymphoblasts also appears to be up-regulated in patients who are treated with high-dose chemotherapy.
23928467 Post-transplant sCD30 serum levels, especially in conjunction with information regarding HLA class II antibodies and serum creatinine levels, provide valuable information regarding graft outcome
23857000 Allostimulation results in the up-regulation of the T-cell activation marker CD30 on CD4 as well as CD8 memory T cells and increased release of sCD30 from these cells in an IFN-gamma- and IL-2-dependent manner.
23797717 Routine testing of CD30 may identify candidates for anti-CD30 targeted therapy.
23790231 These results suggest that CD30 could play a role in the pathogenesis of systemic lupus erythematosus and its expression on CD3 T lymphocytes is not restricted only to Th2-type response
23716562 CD30(+) peripheral T-cell lmyphomas differed significantly from CD30(-) samples.
23716537 CD30 expression on lymphomatous cells makes an attractive target for drug-conjugated antibody-directed therapies.
23654079 There is the association between high levels of soluble serum CD26 and CD30 and disease severity.
23545938 RIP1 is a crucial mediator of CD30-induced cell death in anaplastic large-cell lymphoma cells.
23503451 Soluble CD30 levels are significantly reduced in combination immunosuppression but are differentially affected by different immunosuppressant agents.
23477385 High pretransplant levels of serum soluble CD30 can be a risk factor for kidney transplant rejection, and its high negative predictive value at various cutoffs make it useful to find candidates with a low risk of acute rejection after transplant.
23343832 It seems appropriate to consider CD30(+) diffuse large B-cell lymphoma as a distinct subgroup.
23333304 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tumor necrosis factor receptor superfamily, member 8 (TNFRSF8, CD30)
23268289 serum concentration during pregnancy is not associated with pre-eclampsia and recurrent pregnancy loss
23244086 High CD30 expressison is associated with primary effusion lymphoma.
23119111 Tumor cell nuclear diameter and CD30 expression were related to survival in extranodal NK/T-cell lymphoma, nasal type.
23079227 Analysis was performed on correlation between soluble CD30 level and acute rejection, lung infection, or renal graft loss respectively.
23039325 Data indicate that the relative numbers of TNFAIP3/CD30 cells were distributed among three groups, corresponding to those having homozygous (11%), heterozygous (32%), and no (57%) deletions in TNFAIP3.
23028875 Distinct motifs in the intracellular domain of human CD30 differentially activate canonical and alternative transcription factor NF-kappaappaB signaling.
22966913 The data suggest that patients with acute myeloid leukemia displaying the high-risk FLT3-ITD mutation, have a high likelihood of having CD30 expression on myeloblasts.
22940451 end-stage renal failure (ESRF) patients showed increased serum sCD30 levels and lower percentages of circulating Tregs as compared to healthy controls
22759804 Data show that upregulation of sCD30, iATP, granzyme B, perforin, and downregulation of HLA-G5 could provide valuable diagnostic standards to identify those recipients in the risk of acute rejection (AR).
22715589 indicate that CD30 is involved in the tumorigenic process of Hodgkin lymphoma (HL), and that it may be useful as a therapeutic target for the treatment of HL
22628304 a novel and unexpected role for CD30/CD30L that contributes to proinflammatory immune responses
22472952 Describe pityriasis lichenoides et varioliformis acuta with numerous CD30(+) cells sharing features of lymphomatoid papulosis and other cutaneous lymphomas.
22451116 increased in serum of ulcerative colitis and Crohn's disease patients
22446727 higher levels of soluble protein in kidney transplant recipients suffering graft loss
22369302 Scattered or diffuse CD30 expression in T-MF was not associated with an absence of CXCR3 expression.
22193227 serum sCD30 levels increased and correlated significantly with disease activity in rheumatoid arthritis patients.
22182633 monitoring of HLA and MICA antibodies as well as sCD30 levels early after transplant has predictive value for early and late allograft dysfunctions and the presence of these factors are detrimental to graft function and survival.
21986812 CD30-targeted therapy in combination with galectin-1 treatment may induce effective killing of ALCL cells but not of HL cells
21860351 The association of CD23 and CD30 antigen blood levels with the development of non-Hodgkin lymphoma in HIV patients is reported.
21505378 posttransplant measurement of sCD30 on day 30 may have a role in subsequent graft loss in kidney transplant recipients
21376809 Soluble CD30 and Hepatocyte growth factor as predictive markers of antibody-mediated rejection of the kidney allograft.
21261503 [REVIEW] observations suggest that advanced systemic mastocytosis has to be considered as a differential diagnosis of CD30-positive lymphoid neoplasms
21186345 CD30 is preferentially expressed in neoplastic mast cells in advanced mast cell neoplasms.
21181928 The data provide evidence that sCD30 can be used as a marker for diagnosing Epstein-Barr virus-associated lymphoproliferative diseases.
20814632 Case Report: Maculopapular drug eruption to valsartan, an angiotensin II receptor 1 antagonist, which was followed by the development of CD30+ pseudolymphomatous lesions.
20631311 Data show that the activation induced suppressive FOXP3(+) Tregs can be distinguished by surface expression of CD30 from nonsuppressive FOXP3(+) effector cells.
20625494 These data suggested the potential role of aberrant lipid raft/GM1 on CD4+ T cells and soluble CD30 in the pathogenesis of systemic Lupus erythematosus.
20620210 increase in serum levels predicts graft-versus-host-disease following allogeneic hematopoietic stem cell transplantation
20600903 High serum levels post-transplantation is associated with poorer graft function at one year
20600901 reduction in serum post-transplant levels correlates with full graft function
20591497 The concentration of sCD30 in maternal serum from preeclamptic women did not differ in comparison with values from healthy controls or pregnancies complicated by isolated fetal intrauterine growth restriction.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20430176 A significant drop of soluble CD30 kidney transplantation was recorded, but serial measurements did not show a difference among subjects who displayed acute rejection episodes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20353374 Measurement of the soluble CD30 level on day 14 after transplant might offer a noninvasive means for recognizing patients at risk of acute graft rejection during the early posttransplant period.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20166880 Altered expression of CD30 and the Il-15 regulation of CD30 highlight the occurrence of peripheral manifestations of celiac disease.
20061689 Younger kidney transplant patients had higher sCD30 concentrations however no correlation existed between the serum concentrations and occurrence of rejection episodes or graft survival.
20036333 Pre-transplant soluble CD30 levels is a predictor of acute rejection, graft loss and pneumonia in renal transplant recipients
19898220 Examine CD30 expression and proliferative fraction in nontransformed mycosis fungoides.
19890350 CD30/CD95 crosstalk experiments showed that CD30 ligation leads to NF-kappaB-mediated c-FLIP upregulation in cutaneous lymphoma cells, which in turn conferred enhanced resistance to CD95-mediated apoptosis
19862340 The present study identified for the first time the existence of CD30 molecules in the basal epithelium of a pterygium.
19782609 Pre-transplant serum CD30 is not a useful biomarker for predicting either acute rejection or recipient survival after heart transplantation.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19765439 Higher levels of soluble CD30, IFN-gamma, and IL-10 posttransplantation in rejecting patients provided evidence for coexistence of cellular and humoral responses in acute kidney graft rejection.
19540595 Data show that TRAF1 is an important molecule mediating both the CD30 signaling-dependent and independent NF-kappaB activation, which prevents the lymphoma cells from spontaneous and induced apoptosis.
19415777 CD30 expression and apoptosis in karyotypically normal and abnormal sublines of the human embryonic stem cell line, was investigated.
19243308 Recruitment of a TRAF2-c-IAP1 complex to the cytoplasmic domain of the CD30 leads to the targeting and degradation of the TRAF2-c-IAP1 heterodimer through a mechanism requiring the RING domain of TRAF2, but not c-IAP1
19131627 identification of aryl hydrocarbon nuclear translocator(ARNT) as a CD30-interacting protein that modulated activity of the RelB subunit of NF-kappaB; findings indicate ARNT functions in concert with RelB in a CD30-induced negative feedback mechanism
19126420 Increased pretransplantation recipient sCD30 appears to be associated with decreased early post-transplantation gas exchange, prolonged intubation, and early mortality
19100394 Serum levels after kidney transplantation predicts acute rejection episodes.
19100393 Increased serum CD30 levels in kidney transplantation patints were observed among patients who were panel-reactive antibody-positive, cytomegalovirus antigens or antibodies positive, on long-term dialysis, and </= 20 years old.
19040559 Higher pre-transplant immunologic reactivity measured by soluble CD30 level was associated with post-transplant infection.
19032830 Serum CD30 levels were higher in Rheumatoid Arthirtis and Undifferentiated Arthritis than in controls at baseline but did not predict remission at one year follow-up in this series
19010142 No evidence to suggest that serum cd30 antigen may be a vvaluable biomarker in renal transplantation outcome.
18983807 Results indicate that the plasma levels of sCD26 and sCD30 are significantly higher in patients with non-healing form of CL than patients with healing form of CL or healthy control.
18926413 Soluble CD30 cannot be used as a biomarker to predict bronchiolitis obliterans after lung transplantation.
18793267 This paper describes two cases of superficial fungal infection of the skin that demonstrate prominent expression of CD30 within the dermal inflammatory infiltrates.
18714536 sCD30 levels are significantly higher in patients with hymenoptera venom allergy and indirectly confirms a preferential T(H)2-type cytokine production in these patients.
18689277 results suggested a possible role of cd30 and cd30L in the pathogenesis of acute leukemia
18589105 Pretransplant CD30 serum concentrations were not associated with deceased-donor kidney graft function at 3 years after transplantation.
18365380 Detection of HLA class II antibodies and serum CD30 measured at least 1 year post-transplant cab predict a subsequent outcome up to 6 years after kidney transplantation.
18320364 In patients with metastatic breast cancer, determining the serum neopterin levels may be useful in estimating survival
18201430 data suggest that the expression of CD30 and CD57 cell markers on T cells could reflect circulating effector T cell early activation in the allergic airway disease.
18187570 we investigated CD30 signaling in Hodgkin's and ALCL cell lines
18165785 Serum CD30 may represent a novel marker for surveillance of hepatic cirrhosis in transplant recipients with chronic hepatitis c virus infection.
18049429 There is an important role for CD30 in thymic selection.
18047935 results strongly suggest sCD30 levels of lung transplant patients increase several months prior to clinical evidence of Bronchiolitis Obliterans Syndrome (BOS); rise in serum sCD30 levels can be used as a marker to detect patients at risk to develop BOS
17973241 study identified the major CD30 gene promoter microsatellite binding activity as transcription factor Yin Yang 1; study also concludes that CD30-MS length per se is not a major driver of increased CD30 expression in anaplastic large cell lymphoma
17965727 constitutive action of aberrantly expressed JunB on hypomethylated CD30 CpG islands of lymphocytes triggers CD30 induction and initiates activation of the JunB-CD30-JunB loop, essential to the pathogenesis of HL and ALCL
17912490 high levels of sCD30 in the common variable immunodeficiency patients with splenomegaly and the presence of lymphoma in a patient with the highest level of sCD30 may suggest a soluble form of this marker as a prognostic tool in such diseases
17889168 Release of circulating sCD30 is a prominent feature of hepatic allograft rejection, which may be a useful markers for its diagnosis.
17853188 Patients with preeclampsia and those who deliver an SGA neonate had a significantly lower serum concentration of sCD30 than normal pregnant women.
17853184 Pregnant women with pyelonephritis had a significantly higher median serum concentration of CD30 antigen than those with a normal pregnancy
17616534 soluble serum CD30 may have a role in rejection of kidney transplants
17557078 thioredoxin-1 affects CD30-dependent changes in lymphocyte effector function
17241668 data show that sCD30 level is significantly higher in non-healing patients compared to those of patients with acute disease. This finding suggests a possible association between sCD30 level and clinical manifestation of the Leishmania tropica infection.
17175368 High levels of sCD30 before heart transplant may be associated with greater immunologic ability and therefore produce a protective effect on the development of infection.
17175343 Neither pre- nor posttransplantation sCD30 levels were associated with acute rejection in liver transplant patients.
17106517 Increase of CD30 expression is associated with advancement of Hodgkin's disease. '
17103120 Significant differences were found between systemic lupus erythematosus patients and controls (p=0.0001).
16980071 Measurement of plasma CD30 is a useful procedure for the recognition of rejection in its earliest stages.
16842522 Patients positive for sCD30 contents are at high risk for the development of donor-specific HLA antibodies and acute rejection after kidney transplantation.
16771810 elevated soluble CD30 and neopterin predict graft deterioration by chronic allograft nephropathy
16722935 Findings provide additional evidence that CD30 expression is not restricted to neoplasms of lymphoid origin.
16651853 Soluble CD30 could be an important biomarker for an immune system environment conducive to B cell hyperactivation and the development of AIDS-associated B cell lymphoma
16641601 Observational study of gene-disease association. (HuGE Navigator)
16378078 Good HLA matching seems to be effective in neutralizing the negative effect of a high pretransplant serum CD30.
16372246 CD30-L/CD30 and IL-6/IL-6R systems could play a major role in the pathogenesis of Graves'disease (GD), but the expression of CD30L/CD30 and IL-6/IL-6R in Hashimoto's thyroiditis (HT) suggests that Th2 mechanisms are involved in tissue damage.
16244703 CD30 antigen is of importance in cell development, and proliferation and is also pathway-related to terminal differentiation in many fetal tissues and organs.
16108830 (p52)2/Bcl-3P ternary complex, which is specifically induced in CD30-stimulated anaplasstic larage cell lymphoma, can modulate expression of apoptosis-related genes regulated by NF-kappaB.
16108827 Expression patterns of the tumor marker CD30, which is a cell surface antigen expressed Hodgkin's lymphoma in mice.
15996240 High pre-transplant levels of soluble CD30 are associated with antibody-mediated rejection of Kidney Transplantation
15990453 CD30 is a costimulatory molecule and marker of a regulatory subpopulation of DCs which induces and modulates immune cells involved in the maintenance of the balance between TH1/TH2 immune responses and tolerance.
15964393 Presence of CD30 T cells correlated with preservation of graft function following lung transplantation.
15919463 This marker provides a risk factor for chronic kidney transplant rejection independent of classical immunological risk factors and may be down-regulated using Tacrolimus treatment.
15880060 Pretransplant soluble CD30 is a more accurate predictor of acute rejection when compared with panel reactive antibodiees in kidney transplantation.
15876358 Elevated CD30 expression is considered one of the causes of constitutive NF-kappaB activation in adult T-cell Leukemia (ATL) cells, and may be involved in ATL development.
15782119 CD30 transformed cells trigger the noncanonical NF-kappaB activation pathway, and suggest that deregulated CD30 signaling contributes to the neoplastic features of Hodgkin Reed Sternberg cells.
15644135 The results showed that: (1) epithelial cells in the developing intestinal crypts express the CD30 (Ki-1) antigen; (2) CD30 expression in these epithelial cells is higher in cases of hormonal administration than in normal gestation.
15356338 Immunity to CD30 could play a role in Marek disease lymphoma regression.
15301860 Observational study of genotype prevalence. (HuGE Navigator)
15291361 results suggest that CD30-mediated apoptosis is not a common feature in this cell type and that p38 MAP kinase is involved in CD30-mediated singal transduction.
15265955 CD30 activation plays a role in eosinophil apoptosis.
15175022 CD30 can act as both a positive and negative growth factor depending on cell type
15050749 CD30-regulated expression of cIAP1 & cIAP2 is mediated by NFkappaB & correlates with protection from etoposide-induced apoptosis. CD30-induced signaling may have a major impact on the clinical outcome of patients with anaplastic large cell lymphoma cells.
15033921 CD30 shedding is stimulated by an elevated local availability of cysteine-rich domain 2 or 5, possibly by forming a docking station for the releasing enzyme through substrate aggregation.
15026356 Increased levels of CD30 is associted with ineffective antitumor immunity in Hodgkin's disease
14726963 the anti-inflammatory activity of IL-4-producing CD30+ CD4+ T cells in rheumatoid arthritis may be limited in the synovium due to a poor induction of surface CD30 and a susceptibility to CD30-mediated cell death.
12875982 Data suggest that overexpression and binding of JunB to the AP-1 site may relieve the repression of the core promoter by CD30 in Hodgkin-Redd Sternberg cells, which provide one basis for the constitutive overexpression of CD30 in Hodgkin's lymphoma.
12799531 REVIEW: role of CD30 in determining the activity of T cells toward synthesis of cytokines and involvement in reactions of Th2 characteristics.
12648280 Observational study of genotype prevalence. (HuGE Navigator)
12568298 REVIEW: the biological link between 2 characteristic features of H-RS cells: CD30 overexpression and constitutive NF-kappaB activation
12557237 Results suggest that the N- and C-termini of the extracellular portion of CD30 are in close vicinity of each other, suggesting a flower-like structure for the membrane-bound homotrimeric CD30 molecule.
12553555 only in a subset of both benign and malignant thyroid nodules the interleukin-6/interleukin-6 receptor signal could be induced by the CD30 ligand/CD30
12389614 REVIEW: CD30-mediated signal transduction pathways and possible roles in Hodgkins disease and anaplastic large cell lymphoma
12165500 CD30, but not 4-1BB or OX-40, is preferentially induced by alloantigen, suggesting that CD30 may be important in human alloimmune responses
12091351 Single-cell analysis of CD30+ cells in lymphomatoid papulosis demonstrates a common clonal T-cell origin.
11971184 constitutive signaling by CD30 drives NF-kappaB activation in Hodgkin-Reed-Sternberg cells
11960307 Observational study of gene-disease association. (HuGE Navigator)
11891807 Differential expression of CD30 and p80 between peripheral blood and bone marrow lymphoma cells is a property of the small cell variant of anaplastic large cell lymphoma.
11728464 expression in T cells up-regulated by CD30L

AA Sequence

MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCE      1 - 70
PDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFP     71 - 140
GTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTR    141 - 210
APDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRT    211 - 280
CECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSP    281 - 350
TQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL    351 - 420
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASP    421 - 490
AGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHY    491 - 560
PEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK                                       561 - 595
//

Text Mined References (189)

PMID Year Title
26884853 2015 Prevalence and clinicopathologic features of CD30-positive de novo diffuse large B-cell lymphoma in Chinese patients: a retrospective study of 232 cases.
26709646 2016 The emerging role of CD30 and p53 as novel targets for therapy in anaplastic large cell lymphoma.
26574847 2016 CD30 Expression by B and T Cells: A Frequent Finding in Angioimmunoblastic T-Cell Lymphoma and Peripheral T-Cell Lymphoma-Not Otherwise Specified.
26371781 2015 Intralymphatic Spread Is a Common Finding in Cutaneous CD30+ Lymphoproliferative Disorders.
26273636 2015 Elevated Serum Levels of Soluble CD30 in Ankylosing Spondylitis Patients and Its Association with Disease Severity-Related Parameters.
26261484 2015 Upregulated expression of CD30 protein in sclerosing angiomatoid nodular transformation (SANT): studies of additional 4 cases and analyses of 6 cases previously published cases.
25840583 2015 CD30 Downregulation, MMAE Resistance, and MDR1 Upregulation Are All Associated with Resistance to Brentuximab Vedotin.
25698648 2015 Post-transplant soluble CD30 levels are associated with early subclinical rejection in kidney transplantation.
25568342 2015 TRAF2 recruitment via T61 in CD30 drives NF?B activation and enhances hESC survival and proliferation.
25567136 2015 Elevated serum sCD23 and sCD30 up to two decades prior to diagnosis associated with increased risk of non-Hodgkin lymphoma.
25548993 2015 Transformation of Sézary syndrome into CD30+ anaplastic large T-cell lymphoma after alemtuzumab therapy with evidence of clonal unity.
25492095 2015 Improvement in lung function is associated with a decrease in serum soluble CD30 in atopic infants.
25349176 2014 A novel recurrent NPM1-TYK2 gene fusion in cutaneous CD30-positive lymphoproliferative disorders.
25288491 2015 Prognostic implications of CD30 expression in extranodal natural killer/T-cell lymphoma according to treatment modalities.
25248878 2015 Occurrence and prognostic relevance of CD30 expression in post-transplant lymphoproliferative disorders.
25145835 2014 The oncogenic JUNB/CD30 axis contributes to cell cycle deregulation in ALK+ anaplastic large cell lymphoma.
25135752 2014 CD30 expression in de novo diffuse large B-cell lymphoma: a population-based study from British Columbia.
24805854 2014 Intralymphatic cutaneous anaplastic large cell lymphoma/lymphomatoid papulosis: expanding the spectrum of CD30-positive lymphoproliferative disorders.
24805132 CD30 expression in malignant vascular tumors and its diagnostic and clinical implications: a study of 146 cases.
24747435 2014 SATB1 overexpression promotes malignant T-cell proliferation in cutaneous CD30+ lymphoproliferative disease by repressing p21.
24745678 2014 CD30 in systemic mastocytosis.
24733422 2015 Complete remission of refractory, ulcerated, primary cutaneous CD30+ anaplastic large cell lymphoma following brentuximab vedotin therapy.
24733405 2015 Lymphomatoid plaquosis - a CD30+ lymphoproliferative rash exhibiting a predilection for recurrence on the same skin sites.
24659185 2014 Protrusion-guided extracellular vesicles mediate CD30 trans-signalling in the microenvironment of Hodgkin's lymphoma.
24492285 2014 Correlation of BAG-3 and heat shock protein 70 with CD30 expression in T-cell lymphomas.
24375064 2013 sCD30 and sCD40L detection in patients with osteosarcoma, chondrosarcoma and Ewing sarcoma.
24111625 2013 CD30 expression by bone marrow mast cells from different diagnostic variants of systemic mastocytosis.
23937105 2014 CD30 expression in acute lymphoblastic leukemia as assessed by flow cytometry analysis.
23928467 2013 Association of high post-transplant soluble CD30 serum levels with chronic allograft nephropathy.
23857000 2013 Release of soluble CD30 after allogeneic stimulation is mediated by memory T cells and regulated by IFN-? and IL-2.
23797717 2013 Loss of Foxp3 is associated with CD30 expression in the anaplastic large cell subtype of adult T-cell leukemia/lymphoma (ATLL) in US/Caribbean patients: potential therapeutic implications for CD30 antibody-mediated therapy.
23790231 2013 Differential expression of CD30 on CD3 T lymphocytes in patients with systemic lupus erythematosus.
23716562 2013 CD30-positive peripheral T-cell lymphomas share molecular and phenotypic features.
23716537 2013 CD30 expression in peripheral T-cell lymphomas.
23654079 2013 Soluble CD26 and CD30 levels in patients with common variable immunodeficiency.
23545938 2013 RIP1 expression is necessary for CD30-mediated cell death induction in anaplastic large-cell lymphoma cells.
23503451 2013 A differential impact of mycophenolic acid, prednisolone, and tacrolimus exposure on sCD30 levels in adult kidney transplant recipients.
23477385 2013 Relation between pretransplant serum levels of soluble CD30 and acute rejection during the first 6 months after a kidney transplant.
23343832 2013 CD30 expression defines a novel subgroup of diffuse large B-cell lymphoma with favorable prognosis and distinct gene expression signature: a report from the International DLBCL Rituximab-CHOP Consortium Program Study.
23268289 2012 Soluble CD30 in normal pregnancy, pre-eclampsia and recurrent pregnancy loss.
23244086 2012 Soluble CD30: a possible serum tumor marker for primary effusion lymphoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23119111 2012 Tumor cell nuclear diameter and CD30 expression as potential prognostic parameter in patients with extranodal NK/T-cell lymphoma, nasal type.
23079227 2012 Post-transplant monitoring of soluble CD30 level as predictor of graft outcome: a single center experience from China.
23039325 2012 Deletion of the TNFAIP3/A20 gene detected by FICTION analysis in classical Hodgkin lymphoma.
23028875 2012 Distinct motifs in the intracellular domain of human CD30 differentially activate canonical and alternative transcription factor NF-?B signaling.
22966913 2013 CD30 expression in acute myeloid leukemia is associated with FLT3-internal tandem duplication mutation and leukocytosis.
22940451 2012 Alloantigen-stimulated induction and release of CD30 in patients with end-stage renal failure.
22759804 2012 Assessment of different biomarkers provides valuable diagnostic standards in the evaluation of the risk of acute rejection.
22715589 2011 Targeted repression of overexpressed CD30 downregulates NF-kappaB and ERK1/2 pathway in Hodgkin lymphoma cell lines.
22628304 2012 A novel role for reciprocal CD30-CD30L signaling in the cross-talk between natural killer and dendritic cells.
22472952 2012 Pityriasis lichenoides et varioliformis acuta with numerous CD30(+) cells: a variant mimicking lymphomatoid papulosis and other cutaneous lymphomas. A clinicopathologic, immunohistochemical, and molecular biological study of 13 cases.
22451116 2012 CD30 ligand/CD30 interaction is involved in pathogenesis of inflammatory bowel disease.
22446727 2012 Predicting renal graft failure by sCD30 levels and de novo HLA antibodies at 1year post-transplantation.
22369302 2012 The expression of CXCR3 and CD30 in mycosis fungoides.
22193227 2012 Serum levels of soluble CD26 and CD30 and their clinical significance in patients with rheumatoid arthritis.
22182633 2012 Clinical relevance of pre and post-transplant immune markers in kidney allograft recipients: anti-HLA and MICA antibodies and serum levels of sCD30 and sMICA.
21986812 2012 Galectin-1-mediated cell death is increased by CD30-induced signaling in anaplastic large cell lymphoma cells but not in Hodgkin lymphoma cells.
21860351 2011 Can serum soluble CD23 or CD30 predict the occurrence of lymphoma in HIV-infected patients?
21505378 2011 Posttransplant sCD30 as a predictor of kidney graft outcome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21376809 2011 Soluble CD30 and Hepatocyte growth factor as predictive markers of antibody-mediated rejection of the kidney allograft.
21261503 2011 Aberrant expression of CD30 in aggressive systemic mastocytosis and mast cell leukemia: a differential diagnosis to consider in aggressive hematopoietic CD30-positive neoplasms.
21186345 2011 Aberrant expression of CD30 in neoplastic mast cells in high-grade mastocytosis.
21181928 2011 Soluble CD30: a serum marker for Epstein-Barr virus-associated lymphoproliferative diseases.
20814632 2010 Valsartan-induced drug eruption followed by CD30+ pseudolymphomatous eruption.
20631311 2010 CD30 discriminates heat shock protein 60-induced FOXP3+ CD4+ T cells with a regulatory phenotype.
20625494 2010 Increased expression of ganglioside GM1 in peripheral CD4+ T cells correlates soluble form of CD30 in Systemic Lupus Erythematosus patients.
20620210 2010 A prospective study of serum soluble CD30 in allogeneic hematopoietic stem cell transplantation.
20600903 2010 Soluble CD30 and Cd27 levels in patients undergoing HLA antibody-incompatible renal transplantation.
20600901 2010 Relative reductions in soluble CD30 levels post-transplant predict acute graft function in islet allograft recipients receiving three different immunosuppression protocols.
20591497 2010 Soluble CD30 in normotensive pregnant women with isolated fetal intrauterine growth restriction: a comparison with preeclamptic women.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20430176 2010 Serial soluble CD30 measurements as a predictor of kidney graft outcome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20353374 2009 Posttransplant soluble CD30 as a predictor of acute renal allograft rejection.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20166880 2010 Altered expression of the lymphocyte activation antigen CD30 in active celiac disease.
20061689 2010 Soluble CD30 in renal transplant recipients: is it a good biomarker to predict rejection?
20036333 2010 Pre-transplant soluble CD30 level as a predictor of not only acute rejection and graft loss but pneumonia in renal transplant recipients.
19898220 2009 CD30 expression and proliferative fraction in nontransformed mycosis fungoides.
19890350 2010 Resistance of cutaneous anaplastic large-cell lymphoma cells to apoptosis by death ligands is enhanced by CD30-mediated overexpression of c-FLIP.
19862340 2009 Study of the expression of CD30 in pterygia compared to healthy conjunctivas.
19782609 2009 Soluble CD30 levels in recipients undergoing heart transplantation do not predict post-transplant outcome.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19765439 2009 TH1/TH2 cytokines and soluble CD30 levels in kidney allograft patients with donor bone marrow cell infusion.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19641626 2009 Local network topology in human protein interaction data predicts functional association.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19540595 2009 TRAF1 is involved in the classical NF-kappaB activation and CD30-induced alternative activity in Hodgkin's lymphoma cells.
19415777 2009 CD30 expression reveals that culture adaptation of human embryonic stem cells can occur through differing routes.
19243308 2009 Two distinct signalling cascades target the NF-kappaB regulatory factor c-IAP1 for degradation.
19131627 2009 The aryl hydrocarbon nuclear translocator alters CD30-mediated NF-kappaB-dependent transcription.
19126420 2009 Elevated pretransplantation soluble CD30 is associated with decreased early allograft function after human lung transplantation.
19100394 2008 Level of soluble CD30 after kidney transplantation correlates with acute rejection episodes.
19100393 2008 High serum level of the soluble CD30 identifies Chinese kidney transplant recipients at high risk of unfavorable outcome.
19040559 CD30, a marker to detect the high-risk kidney transplant recipients.
19032830 Serum soluble CD30 in early arthritis: a sign of inflammation but not a predictor of outcome.
19010142 2008 Association between serum soluble CD30 and serum creatinine before and after renal transplantation.
18983807 2009 Plasma sCD26 and sCD30 levels in cutaneous leishmaniasis.
18926413 2008 Soluble CD30 measured after lung transplantation does not predict bronchiolitis obliterans syndrome in a tacrolimus/mycophenolate mofetil-based immunosuppressive regimen.
18793267 2009 Intradermal CD30-positive mononuclear cells in superficial fungal infections of the skin.
18714536 2008 CD30 serum levels and response to hymenoptera venom immunotherapy.
18689277 2007 Study of gene expression of CD30 variant (CD30v) and CD30 ligand (CD30L) in acute leukemia.
18589105 2008 Does pretransplant soluble CD30 serum concentration affect deceased-donor kidney graft function 3 years after transplantation?
18365380 2006 HLA antibodies and soluble CD30 are associated with poor renal graft outcome: updated results of a single-center cross-sectional study.
18320364 2008 Serum neopterin levels in patients with breast cancer.
18201430 Increased expression of CD30 and CD57 molecules on CD4(+) T cells from children with atopic asthma: a preliminary report.
18187570 2008 CD30-induced signaling is absent in Hodgkin's cells but present in anaplastic large cell lymphoma cells.
18165785 2007 Elevated soluble CD30 characterizes patients with hepatitis C virus-induced liver allograft cirrhosis.
18049429 2007 CD30 (Ber-H2) expression by thymocytes and thymic epithelial cells during the late first and second trimester of gestation: an immunohistochemical and in situ hybridization (ISH) study.
18047935 2008 Soluble CD30 levels as a diagnostic marker for bronchiolitis obliterans syndrome following human lung transplantation.
17973241 2008 The CD30 gene promoter microsatellite binds transcription factor Yin Yang 1 (YY1) and shows genetic instability in anaplastic large cell lymphoma.
17965727 2008 Hypomethylation of CD30 CpG islands with aberrant JunB expression drives CD30 induction in Hodgkin lymphoma and anaplastic large cell lymphoma.
17912490 2008 Increased serum levels of soluble CD30 in patients with common variable immunodeficiency and its clinical implications.
17889168 2007 Value of soluble CD30 in liver transplantation.
17853188 2007 Maternal serum soluble CD30 is increased in normal pregnancy, but decreased in preeclampsia and small for gestational age pregnancies.
17853184 2007 Maternal serum soluble CD30 is increased in pregnancies complicated with acute pyelonephritis.
17616534 2007 High variation of individual soluble serum CD30 levels of pre-transplantation patients: sCD30 a feasible marker for prediction of kidney allograft rejection?
17557078 2007 Selective redox regulation of cytokine receptor signaling by extracellular thioredoxin-1.
17241668 2007 Soluble CD26 and CD30 levels in patients with anthroponotic cutaneous leishmaniasis.
17175368 2006 Evaluation of soluble CD30 as an immunologic marker in heart transplant recipients.
17175343 2006 High serum soluble CD30 does not predict acute rejection in liver transplant patients.
17106517 2006 CD30 expression utilization for the accuracy of classical Hodgkin's lymphoma staging.
17103120 2007 The levels of sCD30 and of sCD40L in a group of patients with systemic lupus erythematodes and their diagnostic value.
16980071 2006 Plasma levels of soluble CD30 in kidney graft recipients as predictors of acute allograft rejection.
16842522 Soluble CD30 concentrations in ESRD patients with and without panel reactive HLA antibodies.
16771810 2006 Post-transplant sCD30 and neopterin as predictors of chronic allograft nephropathy: impact of different immunosuppressive regimens.
16722935 2006 Expression of CD30 (Ber-H2) in nasopharyngeal carcinoma, undifferentiated type and lymphoepithelioma-like carcinoma. A comparison study with anaplastic large cell lymphoma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16651853 2006 Elevated serum soluble CD30 precedes the development of AIDS-associated non-Hodgkin's B cell lymphoma.
16641601 2006 Prognostic values of soluble CD30 and CD30 gene polymorphisms in heart transplantation.
16378078 2005 Serum sCD30 in monitoring of alloresponse in well HLA-matched cadaveric kidney transplantations.
16372246 2006 Immunoexpression of the CD30 ligand/CD30 and IL-6/IL-6R signals in thyroid autoimmune diseases.
16244703 2005 Ber-H2 (CD30) immunohistochemical staining of human fetal tissues.
16108830 2005 Stimulation of CD30 in anaplastic large cell lymphoma leads to production of nuclear factor-kappaB p52, which is associated with hyperphosphorylated Bcl-3.
16108827 2005 Hodgkin's lymphoma cells are efficiently engrafted and tumor marker CD30 is expressed with constitutive nuclear factor-kappaB activity in unconditioned NOD/SCID/gammac(null) mice.
15996240 2005 High pre-transplant soluble CD30 levels are predictive of the grade of rejection.
15990453 2005 CD30 antigen and multiple sclerosis: CD30, an important costimulatory molecule and marker of a regulatory subpopulation of dendritic cells, is involved in the maintenance of the physiological balance between TH1/TH2 immune responses and tolerance. The role of IFNbeta-1a in the treatment of multiple sclerosis.
15964393 2005 CD4-veCD8-ve CD30+ve T cells are detectable in human lung transplant patients and their proportion of the lymphocyte population after in vitro stimulation with donor spleen cells correlates with preservation of lung physiology.
15919463 2005 sCD30 and neopterin as risk factors of chronic renal transplant rejection: impact of cyclosporine A, tacrolimus, and mycophenolate mofetil.
15880060 2005 Evaluation of pretransplant immunologic status in kidney-transplant recipients by panel reactive antibody and soluble CD30 determinations.
15876358 2005 Elevated expression of CD30 in adult T-cell leukemia cell lines: possible role in constitutive NF-kappaB activation.
15782119 2005 Aberrant NF-kappaB2/p52 expression in Hodgkin/Reed-Sternberg cells and CD30-transformed rat fibroblasts.
15644135 2005 Human embryonal epithelial cells of the developing small intestinal crypts can express the Hodgkin-cell associated antigen Ki-1 (CD30) in spontaneous abortions during the first trimester of gestation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356338 2004 Marek's disease is a natural model for lymphomas overexpressing Hodgkin's disease antigen (CD30).
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
15291361 2004 Signal transduction in anaplastic large cell lymphoma cells (ALCL) mediated by the tumor necrosis factor receptor CD30.
15265955 2004 Increased expression and activation of CD30 induce apoptosis in human blood eosinophils.
15175022 2004 Roles for CD30 in the biology and treatment of CD30 lymphoproliferative diseases.
15050749 2004 CD30-induced up-regulation of the inhibitor of apoptosis genes cIAP1 and cIAP2 in anaplastic large cell lymphoma cells.
15033921 2004 The ectodomain shedding of CD30 is specifically regulated by peptide motifs in its cysteine-rich domains 2 and 5.
15026356 2004 CD30 is involved in inhibition of T-cell proliferation by Hodgkin's Reed-Sternberg cells.
14726963 2003 Pathophysiological functions of CD30+ CD4+ T cells in rheumatoid arthritis.
12875982 2003 AP-1 mediated relief of repressive activity of the CD30 promoter microsatellite in Hodgkin and Reed-Sternberg cells.
12799531 2003 Expression and a role of CD30 in regulation of T-cell activity.
12648280 2003 Distribution of human CD30 gene promoter microsatellite alleles in healthy and human immunodeficiency virus-1 infected populations.
12568298 2003 Hodgkin's lymphoma and CD30 signal transduction.
12557237 Human CD30: structural implications from epitope mapping and modeling studies.
12553555 2002 Co-expression of interleukin-6 (IL-6) and interleukin-6 receptor (IL-6R) in thyroid nodules is associated with co-expression of CD30 ligand/CD30 receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12389614 2002 Pleiotropic signal transduction mediated by human CD30: a member of the tumor necrosis factor receptor (TNFR) family.
12165500 2002 CD30 expression identifies the predominant proliferating T lymphocyte population in human alloimmune responses.
12091351 2002 Single-cell analysis of CD30+ cells in lymphomatoid papulosis demonstrates a common clonal T-cell origin.
11986285 2002 Increased levels of soluble CD30 in plasma of patients with Plasmodium falciparum malaria.
11971184 2002 Ligand-independent signaling by overexpressed CD30 drives NF-kappaB activation in Hodgkin-Reed-Sternberg cells.
11960307 2002 Association study between CD30 and CD30 ligand genes and type 1 diabetes in the Japanese population.
11918534 2002 Co-expression of CD30 ligand and interleukin 4 (IL-4) receptors by acute myeloid leukaemia blasts is associated with the expansion of IL-4-producing CD30+ normal T cells.
11754357 2002 Soluble CD30 binds to CD153 with high affinity and blocks transmembrane signaling by CD30.
11728464 2001 CD30L up-regulates CD30 and IL-4 expression by T cells.
10764746 2000 TTRAP, a novel protein that associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor-associated factors (TRAFs), and that inhibits nuclear factor-kappa B activation.
10641597 1999 The tyrosine kinase NPM-ALK, associated with anaplastic large cell lymphoma, binds the intracellular domain of the surface receptor CD30 but is not activated by CD30 stimulation.
10518213 1999 The structural basis for the recognition of diverse receptor sequences by TRAF2.
10192335 1999 Signalling through CD30 protects against autoimmune diabetes mediated by CD8 T cells.
9511754 1998 Cloning and characterization of a cDNA encoding the human homolog of tumor necrosis factor receptor-associated factor 5 (TRAF5).
9353251 1997 CD30-dependent degradation of TRAF2: implications for negative regulation of TRAF signaling and the control of cell survival.
9168896 1997 Binding sites of cytoplasmic effectors TRAF1, 2, and 3 on CD30 and other members of the TNF receptor superfamily.
9104814 1997 TRAF-interacting protein (TRIP): a novel component of the tumor necrosis factor receptor (TNFR)- and CD30-TRAF signaling complexes that inhibits TRAF2-mediated NF-kappaB activation.
8999898 1997 Tumor necrosis factor receptor-associated factor (TRAF) 5 and TRAF2 are involved in CD30-mediated NFkappaB activation.
8839832 1996 A variant CD30 protein lacking extracellular and transmembrane domains is induced in HL-60 by tetradecanoylphorbol acetate and is expressed in alveolar macrophages.
8627180 1996 T cell receptor-dependent cell death of T cell hybridomas mediated by the CD30 cytoplasmic domain in association with tumor necrosis factor receptor-associated factors.
8183550 1994 Hyperphosphorylation of a novel 80 kDa protein-tyrosine kinase similar to Ltk in a human Ki-1 lymphoma cell line, AMS3.
7527901 1994 Opposite effects of the CD30 ligand are not due to CD30 mutations: results from cDNA cloning and sequence comparison of the CD30 antigen from different sources.
6754630 1982 Identification of Hodgkin and Sternberg-reed cells as a unique cell type derived from a newly-detected small-cell population.
2537734 1989 Ki-1 (CD30) antigen is released by Ki-1-positive tumor cells in vitro and in vivo. I. Partial characterization of soluble Ki-1 antigen and detection of the antigen in cell culture supernatants and in serum by an enzyme-linked immunosorbent assay.
1330892 1992 Assignment of the human CD30 (Ki-1) gene to 1p36.
1310894 1992 Molecular cloning and expression of a new member of the nerve growth factor receptor family that is characteristic for Hodgkin's disease.