Property Summary

NCBI Gene PubMed Count 118
PubMed Score 198.16
PubTator Score 169.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2346 3.46 1.7
Rheumatoid Arthritis 1170 3.039 1.5

Gene RIF (108)

PMID Text
26335204 Decoy receptor 3 (DcR3) expression in kidneys has been shown to predict progression of chronic kidney disease.
26238767 Decoy receptor 3 regulates the expression of tryptophan hydroxylase 1 in rheumatoid synovial fibroblasts
26062966 The sDcR3 levels in patients with HIV-1 subtype B were significantly higher than those in patients infected with subtype CRF01_AE. HIV-1 subtype B and slow disease progression were associated with higher levels of sDcR3.
25940317 DcR3 inhibits influenza a virus-induced JNK and ERK activation in human macrophages
25823874 tumour markers DcR3 and growth/differentiation factor (GDF)15 from 100 mul human serum, were quantified.
25647275 study has defined the increased serum and SF samples levels of TL1A and DcR3 in patients with rheumatoid arthritis (RA); findings support the hypothesis that TL1A and DcR3 may contribute to the pathogenesis of RA
25564309 Serum DcR3 expression in primary Sjogren's syndrome (pSS) patients was significantly higher than healthy controls. DcR3 expression in salivary glands of pSS patients was significantly higher than healthy controls.
25422191 Higher DcR3 expression was related to the status of invasion, lymph node metastasis and recurrence in bladder urothelial carcinoma.
25323840 decoy receptor 3 and geriatric nutrition have a role in mortality in chronic hemodialysis patients
25087510 Crystal structures of LIGHT and the LIGHT:DcR3 complex reveal the structural basis for the DcR3-mediated neutralization of LIGHT.
25084482 Inhibition of B cell functions by DcR3 may partially explain the negative correlation between DcR3 level and disease activity in rheumatoid arthritis patients.
24998573 Overexpression of TNFRSF6B is associated with hepatocellular carcinoma.
24786982 A case-control study of esophageal squamous-cell carcinoma (ESCC)found that the DcR3 SNPs were not associated with the risk of ESCC.
24764685 HER2 overexpression is not an independent prognostic marker of colorectal cancer, but DcR3 overexpression is highly correlated with lymph node metastasis and poor overall survival
24741354 The overexpression of DcR3 might play a crucial role in the tumorigenesis, differentiation, and proliferation of glioma.
24612949 DCR3 is overexpressed in breast cancer and in vascular endothelial cells and tumor cells in the lymph nodes, revealing a possible link with lymphangiogenesis.
24597666 High serum DcR3 expression correlated with lymph node metastases in in pancreatic head carcinoma
24204567 our data strongly support the notion that tumor cells utilize binding of DcR3 to TRAIL to escape TRAIL-mediated apoptosis, an extracellular protection system for malignancy.
24107265 DcR3 is a key driver of tumor cell dissemination.
24101127 Our results implied the therapeutic potential of silencing DcR3 expression by RNAi in colon cancer.
23965943 Rare missense mutations in TNFRSF6B have a role in the pathogenesis of some cases of IBD.
23925044 Serum DcR3 level may be useful for detecting Hepatitis Be Antigen (-) Chronic hepatitis B in the active stage, which requires medical treatment.
23912906 DcR3 might regulate the gene expression of various key molecules in rheumatoid arthritis fibroblast-like synoviocytes by binding to TL1A.
23846297 Silencing of decoy receptor 3 (DcR3) expression by siRNA in pancreatic carcinoma cells induces Fas ligand-mediated apoptosis in vitro and in vivo.
23817777 The findings in this study strongly suggest that DcR3 plays important roles in tumor progression of human MFH by decoy as well as non-decoy functions and that DcR3 may serve as a potent therapeutic target for human MFH.
23729807 DcR3 may play an etiologic role in systemic lupus erythematosus through either elevated serum levels of wild-type DcR3 or normal levels of gain-of-function DcR3 proteins that increase lymphocyte proliferation.
23707413 novel regulatory mechanisms of DcR3 expression in psoriasis, particularly in keratinocytes and endothelial cells, provides new insight into the pathogenesis of psoriasis
23652586 DcR3 expression was associated with other prognostic factors including survivin, reduced remission rates, and shorter event-free survival.
23449012 high expression of TNFRSF6B is a novel biomarker for predicting the progression of chronic kidney disease
23186064 Data suggest DcR3 expression in DSV-PTC (diffuse sclerosing variant of papillary thyroid carcinoma) tumor cells promotes polarized macrophage differentiation toward the M2 phenotype and thus has role in recruitment of tumor-associated macrophages.
22672288 DcR3 and ERK1/2 play a vital role in the development of gastric cancer, and they may be new markers for indicating the efficiency of gastric cancer treatment in the future.
22626963 Higher DcR3 levels strongly correlate with inflammation and independently predict cardiovascular and all-cause mortality in CKD patients on hemodialysis.
22581854 These results imply that DcR3 may regulate B cell activation by suppressing the activation of NF-kappaB.
22524850 High expression and amplification of the DcR3 gene is associated with pancreatic carcinoma.
22325083 The increased synovial inflammatory cells infiltration in rheumatoid arthritis and ankylosing spondylitis was associated with the elevated DCR3 expression.
22287720 Significantly enhanced tumor growth and spreading are observed in DcR3-transgenic mice; DcR3-transfectant cells grow faster and result in infiltration by tumor-associated macrophages.
21699018 DcR3 may be regarded as a negative regulator for aggressiveness during the development and progression of certain types of breast cancer
21672030 in active psoriasis, we observed abundant immunostaining for TL1A and significant upregulation of its receptors DR3 and DcR3
21537832 DcR3-Fc inhibits the proliferation induced by TNFalpha or IL-1beta in rheumatoid arthritis.
21395182 EMS1 expression was positively related to DcR3, which might play an important role in the carcinogenesis and development of laryngeal carcinoma.
21300286 Decoy Receptor 3 (DcR3)neutralizes three different TNF ligands: FasL, LIGHT, and TL1A. Crystal structure of DcR3 reported here provides a mechanistic basis for the broadened specificity required to support the decoy function of DcR3.
21293109 The expression of DcR3 in vascular endothelial cells during the early phases of Kaposi's sarcoma-associated herpesvirus infection ensures the successful establishment and maintenance of the viral infection.
21155709 Decoy receptor 3 expression in esophageal squamous cell carcinoma is correlated with tumor invasion and metastasis.
21079743 Data show that an additive gene-gene interaction involving TLR4, PSMG1, Data show that an additive gene-gene interaction involving TLR4, PSMG1, TNFRSF6B and IRGM was identified with CD.and IRGM was identified with CD.
20977315 DcR3 might play a certain role in pathogenesis, progress, and metastasis of hepatocellular carcinoma
20962851 Polymorphisms were associated with MS predisposition, with stronger effect in patients with HHV6 active replication-TNFRSF6B-rs4809330(*)A: P=0.028, OR=1.13; TNFRSF14-rs6684865(*)A: overall P=0.0008, OR=1.2.
20962851 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20675196 The TL1A/DcR3 ligand/receptor pair is upregulated in active ulcerative colitis.
20645287 Serum DcR3 level is a predictor for the nodal metastasis and survival among oral cavity cancer patients and the DcR3 copy number alteration could underlie oral carcinogenesis progression
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20597837 Dcr3 expression and p53-dependent apoptosis signalling pathway regulate cellular response to ionising radiation.
20591579 expression of TNFRSF6B directly correlated with clinical and pathological features of hepatocellular carcinoma.
20567955 DcR3 promoter polymorphism 147C/T might influence the susceptibility to esophageal squamous cell carcinoma in the Chinese Han population, maybe by influencing DcR3 expression.
20567955 Observational study of gene-disease association. (HuGE Navigator)
20392250 The formation of osteoclasts in multiple myeloma bone disease patients involves the secretion of soluble decoy receptor 3.
20187130 We have identified and replicated a novel gene-gene interaction between 2 polymorphisms of TNFRSF members in Spanish patients with RA, based on the hypothesis of shared pathogenic pathways in complex diseases.
20187130 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20007581 A minute amount of DcR3 secreted by transgenic islets renders protection against islet apoptotic primary nonfunction in vivo. DcR3 protects beta cells via the action of downstream molecules Adcyap1 and Bank1.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19821006 DcR3 was highly expressed in serum and joint fluids of rheumatoid arthritis patients.
19748482 DcR3 may play a significant role in macrophages not only by a decoy receptor but also by increasing alpha4 integrin.
19644047 High plasma DcR3(decoy receptor 3 ) levels correlate with development of multiple-organ dysfunction and predict the 28-day mortality in patients with Acute respiratory distress syndrome.
19623168 Observational study of gene-disease association. (HuGE Navigator)
19587706 evidence of the expression of DcR3 in multiple myeloma, and the involvement of this molecule in supporting the survival and formation of osteoclasts from multiple myeloma bone disease patients
19483191 Overexpression of Decoy receptor 3 enhances nasopharyngeal carcinoma cell migration and invasion.
19305072 DcR3 mRNAs were detected by Reverse transcription polymerase chain reaction and their surface expressions were measured by flow cytometry
19269042 The anti-inflammatory properties and high DcR3 concentrations in the CSF warrant further investigations in the expression pattern and the function of DcR3 within the CNS.
19246462 DcR3 expression varies during the menstrual cycle and is regulated by sex steroid hormones in vitro in endometrial cells; decidual DcR3 protein was lower in anembryonic than normal pregnancies
19204726 Observational study of gene-disease association. (HuGE Navigator)
19093253 Elevated levels of DcR3 in tissue are positively correlated with hepatocellular carcinoma growth.
18991242 DcR3 is over-expressed in human GC and positively correlated with development and metastases of gastric lesions
18813347 The assessment of DcR3 expression levels offers valuable prognostic information that could be used to select patients for adjuvant therapy studies.
18758464 TNFRSF6B gene variants are associated with pediatric-onset inflammatory bowel disease.
18758464 Genome-wide association study of gene-disease association. (HuGE Navigator)
18757243 Severe rhaumatoid arthritis stage was associated with highly elevated TL1A and DcR3 serum levels.
18695885 overexpression of DcR3 is associated with a worse prognosis in diffuse large B cell lymphoma and the possible mechanism may act through the increase of chemo-resistance of lymphoma cells
18676680 Observational study of gene-disease association. (HuGE Navigator)
18562337 diagnostic parameter for systemic lupus erythematosus
18376232 High DcR3 expression is associated with advanced stage gastric cancer
18349319 role of DcR3 in the development of tumor-associated macrophages
18256354 variants of IL5RA and TNFRSF6B may predispose to sporadic IgA nephropathy
18256354 Observational study of gene-disease association. (HuGE Navigator)
18251184 Gastric cancer patients with high DcR3 expression presented more advanced pN2 disease than those with low DcR3 expression.
18006694 elucidates a novel mechanism of DcR3-mediated immunosuppression
17968950 DcR3 overexpression could lead to an systemic lupus erythematosus-like syndrome in transgenic mice
17802823 Expression of DcR3 protein in laryngeal carcinoma tissues was obviously higher than those in para-carcinoma and normal laryngeal mucosa tissues.
17687076 DCR3 prevents and protects kidney in autoimmune crescentic glomerulonephritis through modulation of T cell activation/proliferation, B cell activation, inhibition of apoptosis, and suppression of mononuclear leukocyte infiltration.
17493146 Observational study of gene-disease association. (HuGE Navigator)
17393415 DcR3 expressed in rheumatoid arthritis fibroblast-like synoviocytes is increased by TNFalpha by protecting the cells against Fas-induced apoptosis; DcR3 may be a therapeutic target in rheumatoid arthritis.
17010447 LIGHT and two of its receptors, a membrane-bound receptor that mediates apoptosis (LTbetaR) and a soluble receptor that interferes with LIGHT signaling (DcR3), were present in syncytiotrophoblast and cytotrophoblast cells in all samples
16210617 Dcr3 transgenic mice provide a model system for the study of modulatory effect of Dcr3 on host immune response in patients suffering from cancers and autoimmune diseases
16040301 significantly more overexpression of DcR3 in high-grade dysplasia or carcinoma in situ and esophageal adenocarcinoma
15661928 DcR3 exerts a direct effect on endothelial cells in activating the NF-kappa B signal pathway, up-regulating transcription of adhesion molecules and IL-8 secretion, and enhancing monocyte adhesion.
15627206 The high DcR3 mRNA expression and protein expression may be positively related to the gene amplification in astrocytic brain tumors, especially glioblastomas.
15475369 athe ability of DCR3 to promote TRAIL-triggered death may be used to potentiate TRAIL efficacy during treatment tumors overexpressing DcR3.
15301860 Observational study of genotype prevalence. (HuGE Navigator)
15215185 DCR3 and cIAP-2 protect trophoblast cells against LIGHT-mediated apoptosis.
14697332 DcR3 is able to induce actin reorganization and enhance the adhesion of monocytes by activating multiple signaling molecules, such as protein kinase C, phosphatidylinositol 3-kinase, focal adhesion kinase and Src kinases.
14688085 data suggest a novel role for TR6 in immune responses to bacteria
14657214 phagocytic activity toward immune complexes and apoptotic bodies as well as the production of free radicals and proinflammatory cytokines in response to lipopolysaccharide were impaired in DcR3.Fc-treated monocyte-derived macrophages
14634066 interferes with the differentiation and maturation of bone marrow-derived dendritic cells
14500635 Recombinant TR6 can inhibit T cell chemotaxis both in vitro and in vivo, an effect that is likely mediated by reverse signaling from TR6 to LIGHT on the T cell surface.
12794752 DcR3 blocks the growth inhibition signals mediated by mFasL
12761893 role in modulating immune cell interactions
12471113 TR6 delivers costimulation through its ligand(s) on the T cell surface, and at least the major part of such costimulation is via LIGHT.
12466117 Data show that mRNA encoding LIGHT and its receptors [HVEM, LTbetaR, and TR6 (DcR3)] are present in placentas and cytotrophoblast cells at term.
12397645 DCR3 is located on 20q13; when amplified in colorectal cancer, patients are less likely to respond to chemotherapy
11994433 As a soluble receptor.Fc fusion protein, DcR3 modulates dendritic cell differentiation and maturation from CD14+ monocytes by up-regulation of CD86/B7.2 and down-regulation of CD40, CD54/ICAM-1, CD80/B7.1, CD1a, and HLA-DR.

AA Sequence

MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQRPCRRDSPTTC      1 - 70
GPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFFAHAGFCLEHASCPPGAGVIA     71 - 140
PGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLALNVPGSSSHDTLCTSCTGFPLSTRVPGAEE    141 - 210
CERAVIDFVAFQDISIKRLQRLLQALEAPEGWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQAL    211 - 280
RVARMPGLERSVRERFLPVH                                                      281 - 300
//

Text Mined References (118)

PMID Year Title
26335204 2015 Expression of decoy receptor 3 in kidneys is associated with allograft survival after kidney transplant rejection.
26238767 2015 Decoy receptor 3 regulates the expression of tryptophan hydroxylase 1 in rheumatoid synovial fibroblasts.
26062966 2015 The serologic decoy receptor 3 (DcR3) levels are associated with slower disease progression in HIV-1/AIDS patients.
25940317 2015 DcR3 suppresses influenza virus-induced macrophage activation and attenuates pulmonary inflammation and lethality.
25823874 2015 Absolute quantification of DcR3 and GDF15 from human serum by LC-ESI MS.
25647275 2015 Serum and synovial fluid levels of tumor necrosis factor-like ligand 1A and decoy receptor 3 in rheumatoid arthritis.
25564309 2015 The expression of death decoy receptor 3 was increased in the patients with primary Sjögren's syndrome.
25422191 2014 Overexpression and clinicopathological contribution of DcR3 in bladder urothelial carcinoma tissues.
25416956 2014 A proteome-scale map of the human interactome network.
25323840 2014 Interaction between geriatric nutritional risk index and decoy receptor 3 predicts mortality in chronic hemodialysis patients.
25087510 2014 Mechanistic basis for functional promiscuity in the TNF and TNF receptor superfamilies: structure of the LIGHT:DcR3 assembly.
25084482 Decoy receptor 3 suppresses B cell functions and has a negative correlation with disease activity in rheumatoid arthritis.
24998573 2014 Effects of miR-152 on cell growth inhibition, motility suppression and apoptosis induction in hepatocellular carcinoma cells.
24786982 2014 Decoy receptor 3 polymorphisms are not associated with the risk of esophageal cancer in a Chinese population.
24764685 2014 Death decoy receptor overexpression and increased malignancy risk in colorectal cancer.
24741354 2014 Overexpression of DcR3 and its significance on tumor cell differentiation and proliferation in glioma.
24612949 2014 Aberrant expression of decoy receptor 3 in human breast cancer: relevance to lymphangiogenesis.
24597666 2014 Decoy receptor 3 (DcR3) overexpression predicts the prognosis and pN2 in pancreatic head carcinoma.
24204567 2013 Reduction of decoy receptor 3 enhances TRAIL-mediated apoptosis in pancreatic cancer.
24107265 2013 The soluble Decoy Receptor 3 is regulated by a PI3K-dependent mechanism and promotes migration and invasion in renal cell carcinoma.
24101127 2013 DcR3 regulates the growth and metastatic potential of SW480 colon cancer cells.
23965943 2013 Targeted resequencing identifies defective variants of decoy receptor 3 in pediatric-onset inflammatory bowel disease.
23925044 2013 Serum decoy receptor 3 is a useful predictor for the active status of chronic hepatitis B in hepatitis B e antigen-negative patients.
23912906 2013 Decoy receptor 3 regulates the expression of various genes in rheumatoid arthritis synovial fibroblasts.
23846297 2013 Silencing of decoy receptor 3 (DcR3) expression by siRNA in pancreatic carcinoma cells induces Fas ligand-mediated apoptosis in vitro and in vivo.
23817777 2013 'Decoy' and 'non-decoy' functions of DcR3 promote malignant potential in human malignant fibrous histiocytoma cells.
23729807 2013 DcR3 mutations in patients with juvenile-onset systemic lupus erythematosus lead to enhanced lymphocyte proliferation.
23707413 2013 EGFR-driven up-regulation of decoy receptor 3 in keratinocytes contributes to the pathogenesis of psoriasis.
23652586 2013 Assessing DcR3 expression in relation to survivin and other prognostic factors in B cell non-Hodgkin's lymphoma.
23449012 2013 Expression of TNFRSF6B in kidneys is a novel predictor for progression of chronic kidney disease.
23186064 2013 Expression of decoy receptor 3 in diffuse sclerosing variant of papillary thyroid carcinoma: correlation with M2 macrophage differentiation and lymphatic invasion.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22886559 2012 Genome-wide association study of glioma and meta-analysis.
22672288 2012 Significance of decoy receptor 3 (Dcr3) and external-signal regulated kinase 1/2 (Erk1/2) in gastric cancer.
22626963 2012 Decoy receptor 3, a novel inflammatory marker, and mortality in hemodialysis patients.
22581854 2012 Decoy receptor 3 suppresses TLR2-mediated B cell activation by targeting NF-?B.
22524850 2012 Clinical significance of expression and amplification of the DcR3 gene in pancreatic carcinomas.
22325083 Overexpression of decoy receptor 3 in synovial tissues of inflammatory arthritis.
22287720 2012 Decoy receptor 3 enhances tumor progression via induction of tumor-associated macrophages.
21699018 2011 Expression of death decoy receptor-3 (DcR3) in human breast cancer and its functional effects on breast cancer cells in vitro.
21672030 2011 Upregulation and nuclear localization of TNF-like cytokine 1A (TL1A) and its receptors DR3 and DcR3 in psoriatic skin lesions.
21537832 2011 DcR3-TL1A signalling inhibits cytokine-induced proliferation of rheumatoid synovial fibroblasts.
21395182 2010 [The expression of EMS1 and DcR3 protein in laryngeal carcinoma and the relation between EMS1 and DcR3].
21300286 2011 Decoy strategies: the structure of TL1A:DcR3 complex.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21293109 2012 Expression of DcR3 and its effects in kaposi's sarcoma-associated herpesvirus-infected human endothelial cells.
21155709 2011 Decoy receptor 3 expression in esophageal squamous cell carcinoma: correlation with tumour invasion and metastasis.
21079743 2010 Interaction of Crohn's disease susceptibility genes in an Australian paediatric cohort.
20977315 2010 Significance of decoy receptor 3 in sera of hepatocellular carcinoma patients.
20962851 2011 Members 6B and 14 of the TNF receptor superfamily in multiple sclerosis predisposition.
20675196 2010 High intestinal and systemic levels of decoy receptor 3 (DcR3) and its ligand TL1A in active ulcerative colitis.
20645287 2011 Serum decoy receptor 3 level: a predictive marker for nodal metastasis and survival among oral cavity cancer patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20597837 2010 Dcr3 inhibit p53-dependent apoptosis in gamma-irradiated lung cancer cells.
20591579 2010 TNFRSF6B neutralization antibody inhibits proliferation and induces apoptosis in hepatocellular carcinoma cell.
20567955 2010 Polymorphisms of decoy receptor 3 are associated with risk of esophageal squamous cell carcinoma in Chinese Han.
20392250 2010 The formation of osteoclasts in multiple myeloma bone disease patients involves the secretion of soluble decoy receptor 3.
20187130 2010 Evidence of epistasis between TNFRSF14 and TNFRSF6B polymorphisms in patients with rheumatoid arthritis.
20007581 2009 DcR3 protects islet beta cells from apoptosis through modulating Adcyap1 and Bank1 expression.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19821006 2010 Decoy receptor 3 is highly expressed in patients with rheumatoid arthritis.
19748482 2009 DcR3 protects THP-1 macrophages from apoptosis by increasing integrin alpha4.
19644047 2009 Decoy receptor 3 levels in peripheral blood predict outcomes of acute respiratory distress syndrome.
19623168 2009 Investigation of reported associations between the 20q13 and 21q22 loci and pediatric-onset Crohn's disease in Canadian children.
19587706 2009 Soluble decoy receptor 3 modulates the survival and formation of osteoclasts from multiple myeloma bone disease patients.
19483191 2009 Decoy receptor 3, upregulated by Epstein-Barr virus latent membrane protein 1, enhances nasopharyngeal carcinoma cell migration and invasion.
19305072 Expressions of Fas/DcR3 and RGD-FasL mediated apoptosis in pituitary adenomas.
19269042 2009 The Decoy Receptor 3 (DcR3, TNFRSF6B) suppresses Th17 immune responses and is abundant in human cerebrospinal fluid.
19246462 2009 Decoy receptor 3 expression during the menstrual cycle and pregnancy, and regulation by sex steroids in endometrial cells in vitro.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19093253 2008 Decoy receptor 3 overexpression and immunologic tolerance in hepatocellular carcinoma (HCC) development.
18991242 2008 Over-expression of decoy receptor 3 in gastric precancerous lesions and carcinoma.
18813347 2008 Decoy receptor 3 is a prognostic factor in renal cell cancer.
18758464 2008 Loci on 20q13 and 21q22 are associated with pediatric-onset inflammatory bowel disease.
18757243 2008 Circulating levels of TNF-like cytokine 1A (TL1A) and its decoy receptor 3 (DcR3) in rheumatoid arthritis.
18695885 2008 Expression of a soluble decoy receptor 3 in patients with diffuse large B-cell lymphoma predicts clinical outcome.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18562337 2008 DcR3 as a diagnostic parameter and risk factor for systemic lupus erythematosus.
18376232 2008 High DcR3 expression predicts stage pN2-3 in gastric cancer.
18349319 2008 Epigenetic control of MHC class II expression in tumor-associated macrophages by decoy receptor 3.
18256354 2008 IL5RA and TNFRSF6B gene variants are associated with sporadic IgA nephropathy.
18251184 High DcR3 expression predicts stage pN2 in gastric cancer.
18006694 2008 Apoptosis of dendritic cells induced by decoy receptor 3 (DcR3).
17968950 2007 Overexpression of human decoy receptor 3 in mice results in a systemic lupus erythematosus-like syndrome.
17802823 2007 [Expression of DcR3 protein and its significance in laryngeal carcinoma].
17687076 2007 Decoy receptor 3 ameliorates an autoimmune crescentic glomerulonephritis model in mice.
17493146 2007 A functional Fas promoter polymorphism is associated with a severe phenotype in type 1 autoimmune hepatitis characterized by early development of cirrhosis.
17393415 2007 Decoy receptor 3 expressed in rheumatoid synovial fibroblasts protects the cells against Fas-induced apoptosis.
17010447 2007 Differential cellular expression of LIGHT and its receptors in early gestation human placentas.
16341674 2005 Transcriptome analysis of human gastric cancer.
16210617 2005 Attenuation of Th1 response in decoy receptor 3 transgenic mice.
16040301 2005 Overexpression of decoy receptor 3 in precancerous lesions and adenocarcinoma of the esophagus.
15661928 2005 Decoy receptor 3 increases monocyte adhesion to endothelial cells via NF-kappa B-dependent up-regulation of intercellular adhesion molecule-1, VCAM-1, and IL-8 expression.
15627206 2005 Frequent gene amplification and overexpression of decoy receptor 3 in glioblastoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475369 2004 Sensitization of cells to TRAIL-induced apoptosis by decoy receptor 3.
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
15215185 2004 Soluble receptor (DcR3) and cellular inhibitor of apoptosis-2 (cIAP-2) protect human cytotrophoblast cells against LIGHT-mediated apoptosis.
14697332 2004 Enhanced adhesion of monocytes via reverse signaling triggered by decoy receptor 3.
14688085 2004 Selective induction of tumor necrosis receptor factor 6/decoy receptor 3 release by bacterial antigens in human monocytes and myeloid dendritic cells.
14657214 2004 Modulation of macrophage differentiation and activation by decoy receptor 3.
14634066 2004 Immunomodulatory effect of decoy receptor 3 on the differentiation and function of bone marrow-derived dendritic cells in nonobese diabetic mice: from regulatory mechanism to clinical implication.
14500635 2003 Death decoy receptor TR6/DcR3 inhibits T cell chemotaxis in vitro and in vivo.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12794752 2003 Endogenous decoy receptor 3 blocks the growth inhibition signals mediated by Fas ligand in human pancreatic adenocarcinoma.
12761893 2003 DcR3/TR6 modulates immune cell interactions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471113 2002 A TNF family member LIGHT transduces costimulatory signals into human T cells.
12466117 2002 Differential expression of LIGHT and its receptors in human placental villi and amniochorion membranes.
12397645 2002 DCR3 locus is a predictive marker for 5-fluorouracil-based adjuvant chemotherapy in colorectal cancer.
11994433 2002 Modulation of dendritic cell differentiation and maturation by decoy receptor 3.
11911831 2002 TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11181995 2001 The sequence of the human genome.
10655513 2000 Overexpression of M68/DcR3 in human gastrointestinal tract tumors independent of gene amplification and its location in a four-gene cluster.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10318773 1999 A newly identified member of tumor necrosis factor receptor superfamily (TR6) suppresses LIGHT-mediated apoptosis.
9872321 1998 Genomic amplification of a decoy receptor for Fas ligand in lung and colon cancer.