Property Summary

Ligand Count 1
NCBI Gene PubMed Count 97
PubMed Score 430.21
PubTator Score 199.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis 1.200 4.8e-04
psoriasis 1.400 2.1e-22

Gene RIF (80)

AA Sequence

MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPG      1 - 70
FYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQA     71 - 140
CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP    141 - 210
GGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI       211 - 277
//

Text Mined References (98)

PMID Year Title