Property Summary

NCBI Gene PubMed Count 32
PubMed Score 176.09
PubTator Score 98.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Brain cancer 24 0.0 1.0

Expression

  Differential Expression (30)

Disease log2 FC p
pancreatic cancer 1.800 4.2e-07
malignant mesothelioma -1.200 1.5e-04
psoriasis 1.700 2.9e-10
cutaneous lupus erythematosus 1.300 3.8e-03
cystic fibrosis 3.178 9.0e-08
glioblastoma 1.900 1.6e-02
medulloblastoma, large-cell -1.200 1.2e-03
Duchenne muscular dystrophy 1.225 2.8e-08
Becker muscular dystrophy 1.029 1.2e-03
juvenile dermatomyositis 1.285 8.4e-10
tuberculosis -2.200 4.4e-04
pancreatic ductal adenocarcinoma liver m... 1.666 2.5e-02
non-small cell lung cancer 2.010 2.6e-15
intraductal papillary-mucinous adenoma (... 2.200 1.4e-03
intraductal papillary-mucinous carcinoma... 2.200 3.1e-03
intraductal papillary-mucinous neoplasm ... 2.900 5.5e-03
lung cancer 2.500 6.8e-05
breast carcinoma -1.600 9.8e-06
diabetes mellitus -1.100 1.5e-02
interstitial cystitis -1.400 1.6e-03
lung adenocarcinoma 1.731 3.5e-08
atypical teratoid/rhabdoid tumor -1.200 5.9e-05
pilocytic astrocytoma 2.700 6.1e-11
pancreatic carcinoma -1.200 8.5e-03
nasopharyngeal carcinoma -1.300 2.8e-03
lung carcinoma 1.400 8.8e-18
Pick disease -1.200 1.3e-02
ovarian cancer 2.300 9.7e-05
Gaucher disease type 3 -1.900 2.9e-02
pituitary cancer 1.800 1.1e-03

 GWAS Trait (1)

 CSPA Cell Line (4)

Gene RIF (21)

PMID Text
27487218 data identify a new mechanism underlying tumour cell extravasation and metastasis, and suggest endothelial DR6-mediated necroptotic signalling pathways as targets for anti-metastatic therapies
25113253 Increase in the expression levels of mRNA and protein for the death receptor 6 is associated with various types of gynaecological malignancy.
24806670 These results provide direct support for the model that APP and DR6 function cell autonomously and in the same pathway to control pruning
24806669 Our results support the view that DR6 functions with APP to modulate synaptic density in the adult CNS
24696529 Circulating levels of DR6 and Gpm6B correlate with breast cancer tumor grade.
24374337 our findings provide new insight into a novel mechanism by which DR6 induces downstream signaling in response to an agonist antibody.
24028773 The present findings suggested that DR6 is involved in the pathogenesis of endometriosis by creating the proliferative and anti-apoptotic characteristics of endometriosis.
22761420 DR6-induced apoptosis occurs through a new pathway that is different from the type I and type II pathways through interacting with Bax.
22567163 DR6 serum protein may be a tool to aid in the diagnosis of some sarcomatous tumors to improve treatment planning.
22525750 SAXS measurements on the ectodomain suggested that a dimer defines the minimal physical unit of an unliganded DR6 molecule in solution.
21501873 findings show that DR6 expression is significantly but transiently upregulated only in activated both CD4+ and CD8+ T cells in NF-kappaB and NF-AT dependent manner with a contribution of PI3K-dependent signaling
21337622 The model is used to provide a satisfying structural and energetic interpretation of DR6-growth factor-like domain of NAPP binding and to suggest the possibility of and a mechanism for spontaneous apoptosis.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19654028 N-glycosylation of the extracellular part might participate in directing DR6 into lipid raft membrane microdomains.
17962943 MMP-14 and DR6 are part of a mechanism tumor cells can employ to actively escape detection by the immune system by affecting the generation of antigen presenting cells
16378686 Observational study of gene-disease association. (HuGE Navigator)
15623156 androgen signaling pathway might cross talk with apoptosis signaling pathway through the interaction between ARA267-alpha and DR6
15301860 Observational study of genotype prevalence. (HuGE Navigator)
11714751 DR6 knockout mice are viable and fertile, and show hyperproliferation of T cells when stimulated.
11485735 DR6 mediates T cell proliferation and differentiation in mice.

AA Sequence

MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRATGQVLTCDKC      1 - 70
PAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQS     71 - 140
NATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNV    141 - 210
CGTLPSFSSSTSPSPGTAIFPRPEHMETHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTS    211 - 280
SARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHL    281 - 350
PWMIVLFLLLVLVVIVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDILK    351 - 420
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLISALRQHRRNDV    421 - 490
VEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNAKLENSALLTVEPSPQDKNKGFFVDESEPLLRC    491 - 560
DSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIFDDMLHFLNPEELRVIEEIPQAEDKLDRLFE    561 - 630
IIGVKSQEASQTLLDSVYSHLPDLL                                                 631 - 655
//

Text Mined References (34)

PMID Year Title
27487218 2016 Tumour-cell-induced endothelial cell necroptosis via death receptor 6 promotes metastasis.
25113253 2014 Vascular marker expression during the development of various types of gynaecological malignancy.
24806670 2014 Genetic analysis reveals that amyloid precursor protein and death receptor 6 function in the same pathway to control axonal pruning independent of ?-secretase.
24806669 2014 A death receptor 6-amyloid precursor protein pathway regulates synapse density in the mature CNS but does not contribute to Alzheimer's disease-related pathophysiology in murine models.
24696529 2014 Breast carcinoma progression and tumour vascular markers related to apoptotic mechanisms.
24374337 2014 Agonist antibody activates death receptor 6 downstream signaling involving TRADD recruitment.
24028773 2013 Death receptor 6 is epigenetically silenced by histone deacetylation in endometriosis and promotes the pathogenesis of endometriosis.
23559013 2013 A DR6/p75(NTR) complex is responsible for ?-amyloid-induced cortical neuron death.
22761420 2012 Death receptor 6 induces apoptosis not through type I or type II pathways, but via a unique mitochondria-dependent pathway by interacting with Bax protein.
22567163 2012 DR6 as a diagnostic and predictive biomarker in adult sarcoma.
22525750 2012 S-SAD phasing study of death receptor 6 and its solution conformation revealed by SAXS.
21725297 2011 Death receptor 6 negatively regulates oligodendrocyte survival, maturation and myelination.
21501873 2011 T-cell activation triggers death receptor-6 expression in a NF-?B and NF-AT dependent manner.
21463639 2011 The crystal structure of death receptor 6 (DR6): a potential receptor of the amyloid precursor protein (APP).
21337622 2011 Computational prediction and analysis of the DR6-NAPP interaction.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19654028 2009 Functional analysis of the posttranslational modifications of the death receptor 6.
19225519 2009 APP binds DR6 to trigger axon pruning and neuron death via distinct caspases.
19165232 2009 Genome-wide association study of panic disorder in the Japanese population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17962943 2008 Tumor-derived death receptor 6 modulates dendritic cell development.
16378686 2006 Exclusion of the juvenile myoclonic epilepsy gene EFHC1 as the cause of migraine on chromosome 6, but association to two rare polymorphisms in MEP1A and RHAG.
15623156 2004 Androgen receptor coregulator ARA267-alpha interacts with death receptor-6 revealed by the yeast two-hybrid.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11753679 2001 Tumor necrosis factor-alpha induces the expression of DR6, a member of the TNF receptor family, through activation of NF-kappaB.
11714751 2001 Impaired c-Jun amino terminal kinase activity and T cell differentiation in death receptor 6-deficient mice.
11485735 2001 Enhanced CD4+ T cell proliferation and Th2 cytokine production in DR6-deficient mice.
9714541 1998 Identification and functional characterization of DR6, a novel death domain-containing TNF receptor.