Property Summary

NCBI Gene PubMed Count 392
PubMed Score 4164.46
PubTator Score 761.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Narcolepsy 69 0.0 5.0

Expression

  Differential Expression (13)

Disease log2 FC p
cutaneous lupus erythematosus 1.600 1.2e-03
osteosarcoma -2.963 2.8e-05
medulloblastoma, large-cell -1.700 1.1e-06
lung cancer -1.700 1.3e-04
interstitial cystitis 1.600 2.1e-03
group 4 medulloblastoma -1.500 4.2e-04
primary Sjogren syndrome 1.300 3.2e-03
subependymal giant cell astrocytoma 1.919 2.9e-03
lung adenocarcinoma -1.398 2.6e-05
lung carcinoma -1.300 7.1e-19
gastric carcinoma 1.300 3.4e-02
ulcerative colitis 1.200 1.6e-04
ovarian cancer 1.400 1.3e-04

Protein-protein Interaction (2)

Gene RIF (388)

PMID Text
26928194 Higher circulating sTNFR1 and sTNFR2 are associated with diabetic kidney disease, and predicts incident cardiovascular disease and mortality independently of microalbuminuria and kidney function in type 2 diabetics.
26574625 Atorvastatin reduced soluble TNFR1/2 receptors in systemic lupus erythematosus.
26569118 NGF has a role in modulating trkANGFR/p75NTR in alphaSMA-expressing conjunctival fibroblasts from human ocular cicatricial pemphigoid
26492598 TNF-alpha/TNFR2 regulatory axis stimulates EphB2-mediated neuroregeneration via activation of NF-kappaB.
26483205 our findings implicate TNFR2 in supporting myeloid-derived suppressor cells -mediated immune suppression and metastasis in the liver
26476273 that U87-p75(NTR) cells express higher levels of Cdh-11 protein and that siRNA-mediated knockdown of Cdh-11 resulted in a significant decrease in p75(NTR)-mediated glioblastoma cell migration
26425877 Pretransplant recipient circulating CD4+CD127lo/-TNFR2+ Treg cell is potentially a simpler alternative to Treg cell function as a pretransplant recipient immune marker for acute kidney injury.
26280204 study suggests that TNFR2(+) Tregs play a role in promoting tumor progressive metastasis
26258847 Recurrent point mutations and genomic gains of TNFRSF1B, encoding the tumor necrosis factor receptor TNFR2, are present in a subset of patients with mycosis fungoides and Sezary syndrome.
26177311 TNFR1 and TNFR2 were significant predictors of disease progression in IgA nephropathy.
26113409 interaction of TNFR1 with TNFR2 determines the biological characters of hypopharyngeal squamous cell carcinoma and TNFR1 may dominate this process
26071216 This meta-analysis demonstrates that TNFRSF1B T allele carriers show a better response to anti-TNF therapy--{REVIEW}
26019295 ADAM17 was identified as the protease responsible for TNFR2 shedding by CD8(+) T cells, with ADAM17 and TNFR2 required in "cis" for shedding to occur.
25982858 variations in the genes governing the levels of constitutive and inducible TNF-alpha and TNF RII might be an important risk factor, which could explain the variable outcomes of hepatitis B virus infection.
25940088 hTNFR2 blocks the biological activity of lymphotoxin beta.
25889297 CXCL13 and CCL4 could act as circulating biomarkers in autoimmune hemolytic anemia (AIHA), and higher plasma soluble TNFRII might favor the diagnosis of SLE-related instead of primary AIHA.
25860248 Circulating TNF receptors 1 and 2 are associated with the severity of renal interstitial fibrosis in IgA nephropathy
25854576 NRH2 enhanced the ratio of Bax/Bcl-2 by promoting the expressions of proNGF, sortilin and p75NTR, thereby inducing brain cell apoptosis.
25828588 serum concentrations of soluble TNFalpha and its receptors (sTNFRI and sTNFRII) in patients with rheumatoid arthritis, were evaluated.
25783484 Markedly elevated concentrations of circulating TNFR1/2 were correlated with the occurrence of contrast-induced kidney injury.
25749018 This study found that the mRNA expression of IL-1R1, TNFR1, and TNFR2 was significantly higher in schizophreina patients compared with normal control subjects
25537528 In conclusion, we report a significant association between the TNFRSF1B p.M196R variant and the risk for psoriasis and the response to treatment with anti-TNF or anti-Il-12/Il-23.
25497703 autonomous TNF/TNFR2 signaling is attenuated by TNF inhibitors that directly target Th17 cells in psoriasis
25419735 Data show that TNF-alpha receptor TNFR2 mRNA expression was significantly increased after 6, 9 and 12 hours of poly (I:C) stimulation.
25416967 Data show that the interplay between the two TNF receptors (TNFR1 and TNFR2) was apparent in the expression pattern of lectin-type oxidized LDL receptor 1 (LOX-1) in response to TNF-alpha.
25363549 Increased plasma level of sTNFRII is found to be associated with exudative age-related macular degeneration.
25292131 A negative correlation of p55/p75 ratio with prolactin and a positive correlations of p55/p75 ratio with insulin level and HOMAIR insulin resistance factor were found.
25288570 Dendritic cell maturation and survival are differentially regulated by TNFR1 and TNFR2.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B, CD120b)
25229755 TNFR2 and IL-12 signaling, which support one another, enables slanDCs to enhance NK-cell function through mTNF-alpha, thereby regulating immune responses.
25152365 Only TNFR2 can induce TRAF2 degradation.
25113639 TNF-alpha and TNFRII polymorphisms might be genetic risk factors for cervical cancer in Tunisian population.
25098821 This study demonstrated that cTNFRs levels at the time of initial diagnosis could predict renal progression in patients with iMN.
25086184 IGFBP-3 inhibits TNF-alpha production and TNFR-2 signaling to protect against retinal endothelial cell apoptosis in diabetic retinopathy.
25061744 The TNFRII nt587 G/G genotype may increase the risk of developing AS in the Chinese population.
25039986 Expression of tumour necrosis factor-alpha and its receptors in Hodgkin lymphoma.
25034210 Plasma sTNFR2 was higher during pregnancy compared with controls. Urinary levels of sTNFR2 were higher in preeclampsia and pregnant women compared with controls.
25010932 association of TNF-alpha, TNFRSF1A and TNFRSF1B gene polymorphisms with the risk of sporadic breast cancer
24923671 Inflammation mediated through TNFalpha and its receptors, TNFR1 and TNFR2, may represent an important component of a comorbidity-induced inflammatory response that partially drives the pathophysiology of heart failure (HF) with preserved ejection fraction.
24898299 Serum TNFR2 is associated with renal decline and ESRD risk in type 1 diabetes and proteinuria.
24896334 Studies indicate that tumor necrosis factors TNF-alpha/TNF-beta and their receptor TNFR1 and TNFR2 play a regulatory role of different immune cells.
24844917 Report role of TNF-alpha/TNFR1/TNFR2 signaling system in mononuclear cells recovered from peritoneal fluid of women with endometriosis at different stages.
24836084 Blood levels of CRP, IL-6 and TNFalpha-R2 are not associated with incident depression.
24782596 tumor necrosis factor receptor genetic polymorphisms affect the expression levels of membrane-bound type I and type II receptors
24777778 Functional TNFR2 196 M/R polymorphism is associated with susceptibility to rheumatoid arthritis in the European population.
24748490 Demonstrate the presence of soluble receptors for TNF-alpha in the synovial fluid of patients with primary knee OA and the relationship of these receptors with clinical parameters.
24717758 High TNF receptor 2 is closely associated with the loss of kidney function.
24711449 TNF-TNFR2 signaling may induce RBR in naive BM-EPCs and that blocking TNF-TNFR2 signaling may prevent delayed RBR in BM-EPCs, conceivably, in bone marrow milieu in general
24578190 The levels of proinflammatory adaptive cytokines and shed TNF receptors are elevated prior to disease flare in systemic lupus erythematosus.
24511129 Our findings from two independent community-based cohorts confirm and extend results of previous studies supporting circulating sTNFRs as relevant biomarkers for kidney damage and dysfunction in elderly individuals, even in the absence of diabetes.
24457057 The biomarker signature consisting of TNFR-II, TGF-alpha, TIMP-1 and CRP is significantly prognostic of survival in patients with high-risk melanoma.
24310780 Addition of leukemia inhibitory factor (LIF) neutralizing antibodies inhibited oligodendrocyte differentiation, indicating a crucial role of TNFR2-induced astrocyte derived LIF for oligodendrocyte maturation
24301904 Among Parkinson disease patients, increased sTNFR1 and sTNFR2 concentrations were associated with poorer cognitive test scores.
24165468 data suggest that the receptors for IL-6 and TNFalpha, rather than the cytokines themselves, may be better indicators of early vascular changes that are associated with cardiovascular diseases
24136332 Higher plasma TNFR75 levels were associated with decreased time to first COPD exacerbatino in a prospective study.
24121042 Our results support a role of TNFRSF1B gene variants in the response to IFX in CD patients.
24076392 Using primary oligodendrocytes of transgenic mice expressing human TNFR2, we show here that TNFR2 is primarily expressed on oligodendrocyte progenitor cells.
23948613 CD25hiFOXP3 + cells expressing TNFR2 are the most active regulatory T cell subset in ovarian cancer and can potently suppress effector T cells by exhibiting distinct properties
23895422 Abeta oligomer increases sortilin gene and protein expression through p75(NTR) and RhoA signaling pathways
23861542 Release of nonmuscle myosin II from the cytosolic domain of tumor necrosis factor receptor 2 is required for target gene expression.
23799986 genetic association studies in a population of women in Tunisia: Data suggest that an SNP in exon 6 of TNFR2/TNFRSF1B (rs1061622) is associated with pre-eclampsia.
23712715 Hypoxia-induced c-kit(+) cardiac stem cells activation is mediated by TNF/TNFR2/Lin-28 signaling.
23672298 Serum TNFR2 expression levels might be a powerful prognostic factor for patients treated with the R-CHOP regimen.
23619127 These findings suggest for the first time that TNF-alpha could exert a direct effect on mitochondria via its receptors.
23532748 Increased serum levels of soluble TNFR2 are found in the euthymic period for bipolar patients versus controls.
23408847 In vivo malaria-induced TNF upregulates TNFRII on regulatory T-cells, which might increase their activity and therefore more effectively prevent in fl ammation.
23316846 Application of the protocol-identified differences in the percentage of cells that expressed TNFRs, as well as the absolute number of receptors per cell, among different subpopulations of PBMCs, and between PBMCs cultured with and without LPS.
23095497 Suggest the effects of chronic E(2) to be dependent on TNFR2 signaling in endothelial cells.
23086255 TNF-R75 was higher in anorexia nervosa patients with duration of disease longer than one year as compared to controls and patients with shorter duration. TNF-R75 inversely correlated with BMI and directly with disease duration.
23082052 There were no significant differences in the serum levels of TNF-R2 between patients with colorectal adenoma and healthy control groups.
22921902 The TNFRSF1B 587G allele is not associated with the severity of heart failure phenotype or clinical outcomes in patients with chronic congestive heart failure.
22860894 Genetic polymorphisms of tumour necrosis factor receptor superfamily 1b .... are associated with clinical efficacy and/or acute severe infusion reactions to infliximab in Crohn's disease
22743059 Both internalization and ASK1-interacting protein-1 association are required for TNFR2-dependent JNK and apoptotic signaling in endothelial cells.
22617158 sTNF-R2 might be a mediator in the risk relationship between overweight and diabetes with pancreatic cancer
22573350 peripheral T-cell non-Hodgkin lymphoma patients with high levels of circulating TNFRII had a two-fold increased risk of shorther survival
22547679 the membrane-proximal extracellular stalk regions of TNFR1 and TNFR2 are crucial in controlling responsiveness to soluble TNF
22525685 sTNFR1 levels are higher in children with IDDM, correlate with anthropometric parameters and do not depend on the kind of insulin therapy.
22461090 p75(NTR) expression in five freshly fixed human cochleae was analysed by using immunohistochemistry.
22451321 we show that indeed the mean level of membrane-associated p75(NTR) in the hippocampal formation is significantly higher (~two-fold, p < 0.03) in human Alzheimer's disease brains than in identical samples of hippocampal formation in age-matched controls
22342236 Individuals in the Chinese Han population with the TNFRSF1B 15 bp insertion allele may be at higher risk for migraine, warranting further replication association studies and follow-up functional experiments.
22228740 Protein levels of TNFR1B were significantly higher in term laboring myometrial samples than in nonlabor controls.
22221522 The association of functional single nucleotide polymorphisms of tumor necrosis factor-alfa (TNFA) and TNF receptor 2 (TNFR2) genes in determining the susceptibility to Chagas' disease, is reported.
22215119 Aerobic training increased the plasma concentration of sTNR1 but it decreased the sTNFR2 in elderly women with knee osteoarthritis.
22110694 a soluble human TNFR2 agonist (TNC-scTNF(R2)) rescues human neurons from oxidative stress-induced cell death
22068019 study aimed to examine the hypothesis that TNF is increased in patients infected with hepatitis C virus (HCV) and with diabetes rather than in patients infected with HCV or with diabetes alone.
22057614 study demonstrated that TNFR2 and TROY mRNA levels are enhanced in cutaneous squamous cell carcinoma cells compared to healthy ones in a Tunisian population
21995493 Although the exact biological function for this SNP remains to be explored, our findings suggest a possible role of TNFRSF1B +676 T>G (rs1061622) in the prognosis of NSCLC.
21994466 IL-6- and TNFalpha-induced TNFR2 expression in colon cancer cells is mediated primarily by STAT3 and provide evidence that TNFR2 may contribute to the tumor-promoting roles of STAT3.
21920667 TNFR2 protein levels in annulus fibrosus negatively correlate with pain scores in lumbar disc herniation.
21895688 Pain ratings were negatively associated with salivary soluble TNFalphaRII.
21850048 The TNF-R2 receptor system adjusts the responsiveness of the extrinsic apoptotic pathway in myeloma cells by multiple mechanisms that generate a highly context-dependent net effect on myeloma cell survival.
21849023 A two-stage association analysis suggests that TNFRSF1B variants are not the determinants of genetic risk of type 2 diabetes in North Indians.
21813066 Report association of anti-CCP positivity and carriage of TNFRII susceptibility variant with anti-TNF-alpha response in rheumatoid arthritis.
21809341 Data suggest that up-modulation of TNFR2 surface expression is associated with arecoline-induced death of K562 cells.
21777909 Findings suggest that the 308AA genotype of TNF-alpha and TNFRII 196M/R polymorphism are associated with RA susceptibility, while only the 308GG genotype of TNF-alpha is associated with RA severity.
21673044 ET-1 (Ala288Ser) and TNFR-II (Met196Arg) polymorphisms are associated with development of one or the other form of chronic disease in bancroftian filariasis.
21584225 Lower frequency of CD62L(high) and higher frequency of TNFR2(+) Tregs are associated with inflammatory conditions in type 1 diabetic patients.
21558270 NF-kappaB signal triggering and termination by tumor necrosis factor receptor 2.
21554999 the tumor necrosis factor receptor superfamily member 1B rs1061624-A allele, acting recessively, is a possible risk factor for clinical tuberculosis in females
21523796 There is a critical role of tumor necrosis factor receptor 1, but not 2, in hepatic stellate cell proliferation, extracellular matrix remodeling, and liver fibrogenesis.
21419569 Our results suggest that p75 plays an important role in enhancing both the sensitivity of Trk receptors to low levels of ligand, as well as increasing the specificity of Trks to their cognate ligands
21403886 A significantly higher level of IFN-gamma (P </= .01), TNF-alpha (P </= .0001), and sTNFR-2 (P </= .01) was detected in (erosive) oral lichen planus patients before treatment than in controls.
21393509 study reports that PGRN bound directly to tumor necrosis factor receptors and disturbed the TNFalpha-TNFR interaction
21350240 No significant associations were found between TNFalpha -857C-->T and TNFR2 676T-->G polymorphisms and semen quality. TNFR1 36A allele is associated with increased sperm concentration and motility, supporting the significance of TNFR1 gene in semen quality
21288590 The higher levels of sTNFR1 and sTNFR2 were associated with a greater decline in eGFR in type 2 diabetic patients without proteinuria, especially in diabetic women.
21221075 results suggest that TNFR2 expressed on podocytes and its canonical NF-kappaB signaling may directly interpose the compound pathogenic responses by podocytes to TNF-alpha, in the absence of other TNFR2-positive renal cell types in proliferative podocytopathies
21174572 potential biomarker in predicting preeclampsia
21153362 TNFR2 in neurodegenerative diseases
21153348 Tumor necrosis factor-alpha signaling via TNFR1/p55 is deleterious whereas TNFR2/p75 signaling is protective in adult infarct myocardium
21150695 Data suggest that the effects of necdin deletion on the developing nervous system may depend on the relative expression of p75NTR and TrkA in the cells of particular regions of the nervous system.
20980627 Both soluble TNF receptors 1 and 2 are significantly increased in the peripheral blood of women with asymptomatic malaria, are positively correlated with parasitemia, and are predictive of placental malaria-associated low-birth-weight babies.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20861605 The 196R allele of TNFR2 M196R as well as the 753Gln allele of toll-like receptor 2 Arg753Gln are risk factors for acne vulgaris in Chinese Han patients.
20861605 Observational study of gene-disease association. (HuGE Navigator)
20842464 Data suggest that polymorphism in TNFR2 or a gene in proximity seems to be associated specifically with paranoid schizophrenia, at least in the Tunisian population.
20842464 Observational study of gene-disease association. (HuGE Navigator)
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20646319 TNFRSF1B A1466G is associated with not complete response to 5-fluorouracil/cisplatin-based chemoradiotherapy in esophageal squamous cell carcinoma.
20646319 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20556591 The high frequency of 196R allele in the functional M196R polymorphism of TNFR2 is a risk factor for acne vulgaris in Han Chinese.
20548340 These results provide the first report of an association between TNFA, TNFB and TNFRII polymorphic features and outcome of allo-HSCT in a Chinese population, and suggest an interaction between TNFA-857 and TNFB+252 genotypes and risk of aGVHD.
20548340 Observational study of gene-disease association. (HuGE Navigator)
20516030 TNFR1 and TNFR2 expression was negatively correlated with disease activity in patients with systemic lupus erythematosus.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20488723 These results suggest association between sTNF-RII levels and polymorphisms in vicinity to TNF-RII promoter region.
20488723 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20430728 Results suggest that tissue expression of TNF-R2, but not TNF-R1, in epithelial ovarian cancer was correlated with the highest risk of cancer progression, and that TNF-alpha may therefore play a role in disease progression.
20401725 Significant genetic association of TNFR2 with rheumatoid arthritis is observed among Caucasian and South Asian patients living in East Midlands, United Kingdom.
20401725 Observational study of gene-disease association. (HuGE Navigator)
20395596 Data support a critical role for endothelial TNFR2 in ischemia-mediated adaptive angiogenesis.
20371430 Serum concentrations of TNFalpha and its receptors, TNFR2, were significantly higher in obese children with NAFLD compared to controls.
20369486 Polymorphism in 196 site of TNFR II gene was not crucial in preterm labor genesis in Han Chinese.
20369486 Observational study of gene-disease association. (HuGE Navigator)
20305143 Observational study of gene-disease association. (HuGE Navigator)
20300049 common SNPs spanning the TNFR2 and TNF cleavage enzyme (TACE) genes do not have a major effect on the response to anti-TNF therapy in rheumatoid arthritis patients
20300049 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20217072 Observational study of gene-disease association. (HuGE Navigator)
20181891 Our findings thus provide new mechanistic insight into the role of TNF and TNFR2 in the pathogenesis of autoimmunity.
20110607 This study demonstrated that TNFRI levels are increased whereas TNFRII levels are decreased in the brains of patient with alzheimer disease compared to non-demented brains.
20100586 Observational study of gene-disease association. (HuGE Navigator)
20074459 Etanercept reduced TNF, TNF-RI and TNF-RII immunostaining in lesional and non-lesional skin samples of psoriasis patients.
20045350 Macrophages that expressed tmTNF mutants with selectivity for either TNFR1 or TNRF2 as a tool to evaluate signaling through these receptors, were generated.
20038584 Data demonstrate in various tumor cell lines and primary T-cells that TNFR2, but not TNFR1, induces activation of the alternative NFkappaB pathway and p100 processing.
20007930 four SNPs associated with tuberculosis suceptibility, especially in women
20007930 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19900796 Observational study of gene-disease association. (HuGE Navigator)
19892918 Observational study of gene-disease association. (HuGE Navigator)
19846171 TNFr2 was positively associated with HOMA-IR (r = 0.21, P < .0001).
19845893 Metabolic syndrome and diabetes are associated with higher plasma concentrations of TNF-alpha and its receptors.
19839997 Plasma levels of sTNF-R1 and vWf were statistically significantly increased in both bipolar disorder and schizophrenia compared to control and were also increased in unmedicated patients.
19825522 The results of the present study suggested that preoperative plasma TNF-alpha and sTNF-Rs levels in epithelial ovarian cancer patients correlated with the highest risk of cancer progression.
19811435 polymorphisms in the TNF-alpha and TNF receptor type 2 (TNFR2) genes may be related to variation in TNF-alpha and TNFR2 expression during immune response to various stimuli in Asian Indians.
19811435 Observational study of gene-disease association. (HuGE Navigator)
19801788 TNF-alphaRI and TNF- alphaRII serum concentrations are more important and better predictive factors than TNF-alpha in rheumatoid arthritis course and in the active forms of the disease.
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19772798 The higher frequency of the wild type TNFR2 676T allele in AS patients suggests the functional ability of TNFR2 to support increased TNF-alpha mediated immunoactivity.
19772798 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19738620 Observational study of gene-disease association. (HuGE Navigator)
19692652 TGF-alpha stimulates human bone marrow mesenchymal stem cells to produce hepatocyte growth factor by TNFR2-dependent mechanisms
19684152 The association between cigarette smoking and systemic lupus erythematosus could be differentiated by the TNFRSF1B rs1061622 T allele among female Japanese subjects.
19684152 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19650780 plasma levels are more closely related to abdominal adipose tissue accumulation than to total adiposity and are independently related to plasma glucose-insulin homeostasis
19641466 These results did not support an association between 36 TNFR1, 676 TNFR2 gene polymorphisms and acute alcoholic hepatitis.
19641466 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19561157 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19557004 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19497711 A trend towards over-representation of tumor necrosis factor receptor 2 +587 G allele was found in oral lichen planus (OLP) patients compared with the controls, suggesting that TNFR2 +587 gene polymorphism may be associated with susceptibility to OLP.
19497711 Observational study of gene-disease association. (HuGE Navigator)
19473970 Data show that FOXO3a regulates oxygen-dependent changes in expression of TNFR2 in HDMECs, controlling sensitivity to TNF-mediated apoptosis.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19442614 The results suggest that TNFRSF1B at 1p36, individually or in different combinations, contribute to osteoporosis susceptibility in Chinese.
19422935 Observational study of gene-disease association. (HuGE Navigator)
19421420 Observational study of gene-disease association. (HuGE Navigator)
19369902 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19343543 Observational study of gene-disease association. (HuGE Navigator)
19339767 Soluble TNFR-75 level in induced sputum positively correlated with lung function
19336370 Observational study of gene-disease association. (HuGE Navigator)
19287455 TRAF1 shifts the quality of integrated TNFR1-TNFR2 signaling from apoptosis induction to proinflammatory NFkappaB signaling.
19262425 Analysis of the common variation in the selected candidate genes did not provide strong evidence to implicate their involvement in varying patient response to anti-TNF treatment.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19246939 Due to different signal transduction properties of both receptors in the natural course of multiple sclerosis, TNF-alpha signaling in leukocytes via TNF-R1 might be beneficial, but detrimental via proinflammatory TNF-R2.
19238748 Observational study of gene-disease association. (HuGE Navigator)
19212208 Although individually there was no association between TNFRII T587G or TNF-alpha G238A polymorphisms and Alcoholic Liver Disease, this study suggests that the presence of both polymorphisms may enhance the susceptibility for ALD.
19212208 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19193342 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19177266 study found a significant association between ankylosing spondylitis and the TNFRII exon 6 196(T/G) polymorphism
19174780 Observational study of gene-disease association. (HuGE Navigator)
19141860 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19070941 Patients with mild cognitive impairment who subsequently developed Alzheimer's disease or vascular dementia already had higher levels of soluble TNFR2 in both CSF and plasma at baseline when compared to age-matched controls.
19068596 Observational study of gene-disease association. (HuGE Navigator)
19050632 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18807256 amniotic fluid TNF-alpha and soluble TNF receptor concentration regulation is affected by race and preterm birth
18807256 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18764880 Expression of TNFRII might play an important role in the angiogenesis, tumour cell proliferation and metastasis of Invasive micropapillary carcinoma of the breast .
18755894 TNF and a TNFR2 agonist may offer highly targeted therapies, with the latter likely to be less systemically toxic
18717726 A downregulated TNFR1-dependent pathway plays a role in plateau-phase acute inflammatory demyelinating polyradiculoneuropathy.
18715339 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18685868 The TNFR2 gene polymorphisms contribute to the variation of obesity phenotypes.
18685868 Observational study of gene-disease association. (HuGE Navigator)
18679053 Serum levels of sTNFR1 and sTNFR2 were increased in schizophrenic patients when compared with controls (all p < 0.05), but there was no difference in TNF-alpha levels.
18671942 These results suggest an important role for Smurf2 binding to TRAF2 in determining specific signalling outputs of TNF-R2.
18636124 Observational study of gene-disease association. (HuGE Navigator)
18571427 TNFRII was implicated in Graves disease development in the Tunisian population
18571427 Observational study of gene-disease association. (HuGE Navigator)
18565259 statistically significant association between the TNFRSF1B-M196R single nucleotide polymorphism and response to infliximab in a French cohort
18565259 Observational study of gene-disease association. (HuGE Navigator)
18544535 oxidative stress promotes TNFR receptor (TNFR1- and TNFR2) self-interaction and ligand-independent and enhanced ligand-dependent TNF signaling
18538149 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18535030 Observational study of gene-disease association. (HuGE Navigator)
18510047 Higher percentage of peritoneal fluid macrophages expressing TNFR1 and TNFR2 proteins in endometriosis suggests dependence of these cells on TNF-alpha stimulation.
18417150 Engineered chimeric receptor from TNFRSF1B and Fas protein which could be used to screen for TNFR2-related therapeutic molecules.
18415772 sTNFR1 and sTNFR2 were found at increased plasma concentrations in active Behcet's disease (BD), with the highest concentration in active BD with arthritis.
18385279 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18337349 The circulating levels of sTNF-R2 were approximately 60% higher in Trypanosoma cruzi-infected than in non-infected neonates (1,635 +/- 101 and 1,027 +/- 100 pg/mL, respectively) and remained higher at 1 year of age.
18309487 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18248655 These results suggest that tumour necrosis factor receptor genotypes may be involved in the different responses to infliximab in Japanese patients with Crohn's disease.
18248655 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18206417 TNF-alpha-308 G/A may be related to susceptibility, whereas -609 TT TNFR1 and 1690 C/T TNFR2 SNPs may be protective to tobacco-related oral squamous cell carcinoma.
18206417 Observational study of gene-disease association. (HuGE Navigator)
18173921 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18088549 noticed the largest number of mRNA copies for TNFalpha and TNF R2/R7 in healthy cells at stage III of the disease
18083240 The increase of plasma TNF-alpha in amyotrophic lateral sclerosis (ALS) patients in the presence of a slight increase of sTNFR-1 & -2 supports a functionally significant activation of the TNF system in ALS.
18080762 TNFalphaRII levels were assessed in chronic liver diseases as possible marker to assess severity of disease/response to treatment.
18068948 Data show that Type D personality is associated with substantially increased TNFR2 and TNF-alpha activity.
18038243 Genetic variation in TNFRSF1B plays a role in the determination of bone structure in Caucasian postmenopausal women, possibly through effects on osteoblast and osteoclast differentiation.
18038243 Observational study of gene-disease association. (HuGE Navigator)
17998218 study failed to demonstrate an association of TNFR2 T676G polymorphism with primary Sjogren's syndrome
17852784 Transplantation of TNFRSF1B-transfected mesenchymal stem cells improved left ventricular function following myocardial infarction.
17825894 TNF-RII-supported TCR costimulation is defective in common variable immunodeficiency.
17785864 Transmembrane tumor necrosis factor (TNF) and TNF receptor (TNFR)1/2 are interaction partners contributing to TNF-alpha production in monocytes.
17763205 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17634906 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17530646 Observational study of gene-disease association. (HuGE Navigator)
17346438 Observational study of gene-disease association. (HuGE Navigator)
17331078 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17267158 TNF-RI and -RII promoter gene polymorphisms and variations in protein and gene expression of these receptors are unlikely to play a major role in the development of Alzheimer's disease
17258924 Positively associated with vascular cell adhesion molecule 1 in type 2 diabetes and insulin resistance
17220297 TNFR2 signaling induces selective c-IAP1-dependent ASK1 ubiquitination and terminates mitogen-activated protein kinase signaling
17207711 Observational study of gene-disease association. (HuGE Navigator)
17207711 A genetic difference in TNFR2 promoter variable number of tandem repeats may play a major role in susceptibility to invasive pulmonary aspergillosis
17028114 Observational study of gene-disease association. (HuGE Navigator)
17028114 196R allele of the functional M196R polymorphism of TNF-RII is a risk factor for systemic lupus erythematosus, especially in the Asian population (Review)
16980123 Observational study of gene-disease association. (HuGE Navigator)
16979382 In summary, the circulating concentration of DS-TNFR2 seems to be inversely linked to metabolic disorders, hinting at a possible anti-inflammatory role.
16871413 There is an association of tumor necrosis factor receptor 2 M196R polymorphism with knee osteoarthritis, but not rheumatoid arthritis.
16871413 Observational study of gene-disease association. (HuGE Navigator)
16846840 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B, CD120b)
16732051 May have a protective effect in protecting vasodilation in glucose intolerance.
16732050 Independently associated with brachial-ankle pulse-wave velocity in nonobese Japanese type 2 diabetic patients.
16731080 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16645020 DS-TNFR2 might play a role as a counterpart of the proinflammatory environment associated with insulin resistance.
16580225 tumor necrosis factor alpha and TNFR1 and TNFR2 have roles in cellular differentiation
16502120 Observational study of gene-disease association. (HuGE Navigator)
16502120 TNFR2 polymorphism is not associated with bone mineral density in two independent Caucasian populations
16282562 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16277675 Observational study of gene-disease association. (HuGE Navigator)
16195372 TNFR1 and TNFR2 have roles in cell type-specific renal injury
16142859 Observational study of gene-disease association. (HuGE Navigator)
16142859 Polymorphism of TNFRSF1B gene are associated with iron deficient anemia in patients diagnosed with rheumatoid arthritis.
16003175 Observational study of gene-disease association. (HuGE Navigator)
16003175 There is no association with hypertension of TNFRSF1B polymorphism at a hypertension locus on chromosome 1p36.
15943902 TNFR2 and TNFR1 signal transduction mechanisms involved in activation of NFkappaB and CMV promoter-enhancer were compared with respect to their susceptibility towards inhibitors of intracellular signaling.
15920055 Increased levels of sTNF-RII were strongly associated with risk of coronary disease among diabetic women, independent of hyperglycemia.
15886863 polymorphism of the TNFR2 gene is associated with peak bone density in Chinese nuclear families.
15863392 Observational study of gene-disease association. (HuGE Navigator)
15863392 Genetic variation in TNFRII may predict the late onset of breast carcinoma, relapse and death for patients with breast carcinoma
15851552 Observational study of gene-disease association. (HuGE Navigator)
15851552 Genetic variations in these proinflammatory mediators and their receptors appear to influence the susceptibility and severity of the inflammatory response within the eyes of patients during the development of IAU(idiopathic acute anterior uveitis).
15842589 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15805680 Observational study of gene-disease association. (HuGE Navigator)
15787661 Observational study of gene-disease association. (HuGE Navigator)
15784704 Infliximab reduces solble levels in Crohn disease.
15743036 TNFR2 and TNFR2/R7 are dysregulated and have roles in colorectal cancer
15674653 Observational study of gene-disease association. (HuGE Navigator)
15674653 the polymorphism of the TNFRII, might not participate in the pathogenesis of SLE in Vietnamese.
15657078 The data confirm the capacity of TNFR2 to generate an apoptotic cell death signal independent of TNFR1.
15603867 Observational study of gene-disease association. (HuGE Navigator)
15603867 polymorphism and plasma levels in rheumatoid arthritis
15585313 Observational study of gene-disease association. (HuGE Navigator)
15572357 The mutated form TNFR2(196ARG) shows a reduction of inducible TRAF2 recruitment upon TNF-alpha stimulation
15555301 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15526005 Observational study of gene-disease association. (HuGE Navigator)
15459750 The TNFR2 expression was increased in human leukaemic TF-1 cells by granulocyte macrophage-colony stimulating factor (GM-CSF) and interleukin-3 (IL-3), with TNFR1 expression unaffected.
15457442 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15355698 Observational study of gene-disease association. (HuGE Navigator)
15301860 Observational study of genotype prevalence. (HuGE Navigator)
15274667 Observational study of gene-disease association. (HuGE Navigator)
15252214 Observational study of gene-disease association. (HuGE Navigator)
15212671 Observational study of gene-disease association. (HuGE Navigator)
15212671 TNFR2 polymorphism is not associated with susceptibility to endometriosis.
15146559 Observational study of gene-disease association. (HuGE Navigator)
15142217 Observational study of gene-disease association. (HuGE Navigator)
15091317 Observational study of gene-disease association. (HuGE Navigator)
15091317 The TNFRII 196R G allele does not appear to be associated with Alzheimer's disease susceptibility in a Japanese population.
15071724 Observational study of gene-disease association. (HuGE Navigator)
15041705 Expression of TNF-receptor 2 (TNF-R2) but not TNF-receptor 1 (TNF-R1) was detected in myeloma cell lines.
15022314 Observational study of gene-disease association. (HuGE Navigator)
15022314 Association between the TNFRII 196 M/R gene polymorphism and the functional severity of early rheumatoid arthritis.
15018649 Observational study of gene-disease association. (HuGE Navigator)
15000697 significantly up-regulated in plasma of HIV seropositive patients who used opiates compared to those who did not.
14872483 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14872483 Distribution of the TNFR2 196 R/R and TNFR1 +36 A/A genotypes in familial rheumatoid arthritis could suggest an interaction between TNFR1 and TNFR2 in the genetic susceptibility for rheumatoid arthritis.
14728878 The level of the sTNF-R2 was elevated in myelodysplastic syndrome(MDS) patients.
14688526 Observational study of gene-disease association. (HuGE Navigator)
14688526 Association between recipient and donor TNFRII 196R allele status and acute or extensive chronic GVHD incidence, respectively, may reflect reduced circulating sTNFRII.
14651520 Observational study of gene-disease association. (HuGE Navigator)
14651520 There is a significant association between exon 10 nt 1668*T-->G tumor necrosis factor receptor 2 gene polymorphism of and susceptibility to MS.
14565595 Observational study of gene-disease association. (HuGE Navigator)
14532286 cells pre-stimulated through TNFR-2 prior to subsequent activation of TNFR-1, showed enhanced cell death and recruitment of RIP to the TNFR-1 complex; TNFR-2 signaling may play a role in controlling viral infection
14506926 Deficient expression of TNF-RII mRNA in the endometrium of women at the earliest stages of endometriosis may play a significant role in the pathophysiology of this disease.
12960285 TNF-RII plays a unique role among the T cell costimulatory molecules, as TNF-RII ligation can have positive and negative effects on TCR-dependent signaling.
12918703 Serum levels and Adamantiades-Behcet's disease activity
12882979 TL1A-induced NF-kappaB activation and c-IAP2 production prevent DR3-mediated apoptosis
12880679 levels of sTNFR concentrations were either similar (in sera) or significantly lower (in CM) in the patients with acute HPV infection compared with the controls
12858454 Observational study of gene-disease association. (HuGE Navigator)
12858434 Observational study of gene-disease association. (HuGE Navigator)
12858434 Neither the +36 TNFRSF1A SNP nor the +196 TNFRSF1B SNP is associated with RA severity in a population of Caucasian patients with rheumatoid arthritis.
12786601 TNFR2 activates cytosolic phospholipase A2 (cPLA2) by causing its translocation to plasma membrane and perinuclear subcellular regions and by causing an increase in intracellular calcium that may contribute to the translocation and activation of cPLA2.
12770792 Observational study of gene-disease association. (HuGE Navigator)
12739039 Observational study of gene-disease association. (HuGE Navigator)
12739039 An ethnic difference in the TNFR2 promoter variable number of tandem repeats has been found that may be associated with clinical phenotypes in systemic lupus erythematosus.
12730509 Observational study of gene-disease association. (HuGE Navigator)
12661999 Observational study of gene-disease association. (HuGE Navigator)
12651071 Observational study of gene-disease association. (HuGE Navigator)
12610797 Observational study of gene-disease association. (HuGE Navigator)
12610797 TNFR2ms 18 may have a protective effect on the development of rheumatoid arthritis in Taiwanese, while TNFR2ms 15 tends to have a precipitating effect.
12610052 Plasma sTNFR1 and sTNFR2 were inversely related to insulin sensitivity and might contribute to the development of insulin resistance in glucose-intolerant subjects.
12601524 Observational study of gene-disease association. (HuGE Navigator)
12601524 No association with narcolepsy in German patients, in contrast with Japanese.
12559634 Observational study of gene-disease association. (HuGE Navigator)
12530121 serum levels elevated in asthmatic patients during acute attack
12500222 Elevated serum levels of soluble TNF-alpha receptor type II are strongly associated with the development of acute renal failure in patients with septic shock.
12371624 Review: role in signaling in chronic inflammatory disorders
12370298 TNFR2 binds to Etk but is not involved in Etk activation in human cells
12364441 plasma IL-8 was related to body mass index, percentage of body fat, fat mass and soluble TNF-alpha receptor 2
12353079 Both adipose tissue and blood PAI-1 levels were positively associated with TNFRSF1A and TNFRSF1B in obesity.
12351485 Increased levels of this receptor are found in lean nondiabetic offspring of type 2 diabetic subjects.
12296856 Thalidomide and its analogues have distinct and opposing effects on TNF-alpha and TNFR2 during co-stimulation of both CD4(+) and CD8(+) T cells, suggesting a possible role for TNF-mediated events during co-stimulation.
12233877 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12233877 in patients with rheumatoid arthritis, preliminary study results showed a trend towards a higher prevalence of the GG genotype for the exon 6 TNFRII polymorphism in the less responsive patients with more aggressive disease
12220546 Review. Blockade of the p75TNFR may be helpful in treating systemic autoimmunity since its function may be essential for systemic tissue damage.
12217957 Observational study of gene-disease association. (HuGE Navigator)
12209507 Observational study of gene-disease association. (HuGE Navigator)
12209506 A TNFR2 recessive factor, in linkage disequilibrium with the 196R allele, plays a major role in a subset of families with multiple cases of rheumatoid arthritis.
12161545 Observational study of gene-disease association. (HuGE Navigator)
12161545 methionine 196 arginine polymorphism in exon 6 of the TNF receptor 2 gene (TNFRSF1B) is associated with the polycystic ovary syndrome and hyperandrogenism.
12144133 The high level of TNF alpha expression was noted both for typical and sought TNF R2/R7 isoforms and 3) A considerable number of samples displayed higher levels of TNF R2 isoforms than TNF R2/R7 mRNA expression in differentiated thyroid carcinomas
12122509 a possible marker for the early diagnosis of rejection and for prognosis after renal transplantation
12049175 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12011375 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11979305 Observational study of gene-disease association. (HuGE Navigator)
11979305 polymorphism is associated with the incidence of graft-versus-host disease and relapse rate in unrelated bone marrow transplantation (uBMT)
11961180 Observational study of gene-disease association. (HuGE Navigator)
11961180 TNFRII exon 6 SNP does not seem to be associated with susceptibility to juvenile idiopathic arthritis.
11907583 mediates ubiquitination and degradation of TRAF2
11904678 Observational study of gene-disease association. (HuGE Navigator)
11904678 Polymorphisms of the TNF gene and the TNF receptor superfamily member 1B gene are associated with susceptibility to ulcerative colitis and Crohn's disease, respectively.
11882518 insulin resistance and blood pressure are linked to altered shedding of TNF-alpha receptors in type 2 diabetes mellitus
11861282 induced marked apoptosis in T cells from HIV-infected persons; associated with both alteration of Bcl-2 expression and activation of caspase-8 and caspase-3
11762942 Observational study of gene-disease association. (HuGE Navigator)
11737221 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
11600223 Observational study of gene-disease association. (HuGE Navigator)
11371414 Observational study of gene-disease association. (HuGE Navigator)
11357933 Observational study of gene-disease association. (HuGE Navigator)
11315843 Observational study of gene-disease association. (HuGE Navigator)
11285131 Observational study of gene-disease association. (HuGE Navigator)
11212177 Observational study of gene-disease association. (HuGE Navigator)
11169260 Observational study of gene-disease association. (HuGE Navigator)
11163081 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11144293 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11126399 Observational study of gene-disease association. (HuGE Navigator)
9744279 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B, CD120b)
1335762 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B, CD120b)

AA Sequence

MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKT      1 - 70
SDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPL     71 - 140
RKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMA    141 - 210
PGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVN    211 - 280
CVIMTQVKKKPLCLQREAKVPHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQA    281 - 350
PGVEASGAGEARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ    351 - 420
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS                                 421 - 461
//

Text Mined References (395)

PMID Year Title
26928194 2016 Association of soluble tumor necrosis factor receptors 1 and 2 with nephropathy, cardiovascular events, and total mortality in type 2 diabetes.
26574625 Atorvastatin reduced soluble receptors of TNF-alpha in systemic lupus erythematosus.
26569118 2015 NGF Modulates trkANGFR/p75NTR in ?SMA-Expressing Conjunctival Fibroblasts from Human Ocular Cicatricial Pemphigoid (OCP).
26492598 2016 TNF-?/TNFR2 Regulatory Axis Stimulates EphB2-Mediated Neuroregeneration Via Activation of NF-?B.
26483205 2015 TNF Receptor-2 Facilitates an Immunosuppressive Microenvironment in the Liver to Promote the Colonization and Growth of Hepatic Metastases.
26476273 2015 Gamma-secretase-independent role for cadherin-11 in neurotrophin receptor p75 (p75(NTR)) mediated glioblastoma cell migration.
26425877 2016 Pretransplant Recipient Circulating CD4+CD127lo/- Tumor Necrosis Factor Receptor 2+ Regulatory T Cells: A Surrogate of Regulatory T Cell-Suppressive Function and Predictor of Delayed and Slow Graft Function After Kidney Transplantation.
26280204 2015 Expression of TNFR2 by regulatory T cells in peripheral blood is correlated with clinical pathology of lung cancer patients.
26258847 2015 Genomic analysis of mycosis fungoides and Sézary syndrome identifies recurrent alterations in TNFR2.
26177311 2015 Circulating Tumor Necrosis Factor ? Receptors Predict the Outcomes of Human IgA Nephropathy: A Prospective Cohort Study.
26113409 2015 Interaction between TNFR1 and TNFR2 dominates the clinicopathologic features of human hypopharyneal carcinoma.
26071216 2015 The tumor necrosis factor receptor superfamily member 1B polymorphisms predict response to anti-TNF therapy in patients with autoimmune disease: A meta-analysis.
26019295 2015 Shedding of TNF receptor 2 by effector CD8? T cells by ADAM17 is important for regulating TNF-? availability during influenza infection.
25982858 2015 The relationship between TNF alpha gene polymorphisms (-238/-308), TNF RII VNTR (p75) and outcomes of hepatitis B virus infection in Tunisian population.
25940088 2015 Comparative Biochemical and Functional Analysis of Viral and Human Secreted Tumor Necrosis Factor (TNF) Decoy Receptors.
25889297 2015 CXCL13, CCL4, and sTNFR as circulating inflammatory cytokine markers in primary and SLE-related autoimmune hemolytic anemia.
25860248 2015 Circulating TNF receptors 1 and 2 are associated with the severity of renal interstitial fibrosis in IgA nephropathy.
25854576 2015 [NRH2 induces cell apoptosis of cerebral tissues around hematomas after intracerebral hemorrhage through up-regulating proNGF, sortilin and p75NTR expressions].
25828588 2015 Expression of TNF? membrane-bound receptors in the peripheral blood mononuclear cells (PMBC) in rheumatoid arthritis patients.
25783484 2015 Circulating tumour necrosis factor receptors 1 and 2 predict contrast-induced nephropathy and progressive renal dysfunction: a prospective cohort study.
25749018 2015 Proinflammatory cytokines and their membrane-bound receptors are altered in the lymphocytes of schizophrenia patients.
25537528 2015 The TNFRSF1B rs1061622 polymorphism (p.M196R) is associated with biological drug outcome in Psoriasis patients.
25497703 2015 TNF inhibitors directly target Th17 cells via attenuation of autonomous TNF/TNFR2 signalling in psoriasis.
25456591 2014 Identification of protein O-glycosylation site and corresponding glycans using liquid chromatography-tandem mass spectrometry via mapping accurate mass and retention time shift.
25419735 2014 Hepatitis C virus induced endothelial inflammatory response depends on the functional expression of TNF? receptor subtype 2.
25416967 2015 Differential pro-inflammatory responses of TNF-? receptors (TNFR1 and TNFR2) on LOX-1 signalling.
25363549 2015 Early and exudative age-related macular degeneration is associated with increased plasma levels of soluble TNF receptor II.
25292131 2014 The interaction between menstrual cycle, Tumour Necrosis Factor alpha receptors and sex hormones in healthy non-obese women--results from an observational study.
25288570 2014 Dendritic cell maturation and survival are differentially regulated by TNFR1 and TNFR2.
25229755 2014 TNFR2 and IL-12 coactivation enables slanDCs to support NK-cell function via membrane-bound TNF-?.
25152365 2014 TRAF-mediated modulation of NF-kB AND JNK activation by TNFR2.
25113639 2015 Tumor Necrosis Factor Alpha (-238 / -308) and TNFRII-VNTR (-322) Polymorphisms as Genetic Biomarkers of Susceptibility to Develop Cervical Cancer Among Tunisians.
25098821 2014 Circulating TNF receptors are significant prognostic biomarkers for idiopathic membranous nephropathy.
25086184 2014 IGFBP-3 inhibits TNF-? production and TNFR-2 signaling to protect against retinal endothelial cell apoptosis.
25061744 2014 Tumor necrosis factor receptor-II nt587 polymorphism in Chinese Han patients with ankylosing spondylitis.
25039986 2014 Expression of tumour necrosis factor-? and its receptors in Hodgkin lymphoma.
25034210 2015 Differential regulation of TNF receptors in maternal leukocytes is associated with severe preterm preeclampsia.
25010932 2014 Association of TNF-?, TNFRSF1A and TNFRSF1B gene polymorphisms with the risk of sporadic breast cancer in northeast Chinese Han women.
24923671 2014 Circulating levels of tumor necrosis factor-alpha receptor 2 are increased in heart failure with preserved ejection fraction relative to heart failure with reduced ejection fraction: evidence for a divergence in pathophysiology.
24898299 2014 Synergism between circulating tumor necrosis factor receptor 2 and HbA(1c) in determining renal decline during 5-18 years of follow-up in patients with type 1 diabetes and proteinuria.
24896334 2014 TNF/TNFR: drug target for autoimmune diseases and immune-mediated inflammatory diseases.
24844917 2015 Behavior of tumor necrosis factor-? and tumor necrosis factor receptor 1/tumor necrosis factor receptor 2 system in mononuclear cells recovered from peritoneal fluid of women with endometriosis at different stages.
24836084 2014 C-reactive protein, interleukin-6, soluble tumor necrosis factor ? receptor 2 and incident clinical depression.
24782596 2014 Polymorphisms in the tumor necrosis factor receptor genes affect the expression levels of membrane-bound type I and type II receptors.
24777778 2014 Associations between functional TNFR2 196 M/R polymorphisms and susceptibility to rheumatoid arthritis: a meta-analysis.
24748490 2014 Soluble TNF receptors are produced at sites of inflammation and are inversely associated with self-reported symptoms (WOMAC) in knee osteoarthritis.
24717758 2014 Circulating TNF receptor 2 is closely associated with the kidney function in non-diabetic Japanese subjects.
24711449 2014 TNF-TNFR2/p75 signaling inhibits early and increases delayed nontargeted effects in bone marrow-derived endothelial progenitor cells.
24578190 2014 Proinflammatory adaptive cytokine and shed tumor necrosis factor receptor levels are elevated preceding systemic lupus erythematosus disease flare.
24511129 2014 Soluble TNF receptors and kidney dysfunction in the elderly.
24457057 2014 A four-marker signature of TNF-RII, TGF-?, TIMP-1 and CRP is prognostic of worse survival in high-risk surgically resected melanoma.
24310780 2014 Astrocyte-specific activation of TNFR2 promotes oligodendrocyte maturation by secretion of leukemia inhibitory factor.
24301904 2014 Plasma levels of soluble tumor necrosis factor receptors are associated with cognitive performance in Parkinson's disease.
24165468 2013 Soluble TNF and IL-6 receptors: indicators of vascular health in women without cardiovascular disease.
24136332 2014 Tumour necrosis factor receptor-75 and risk of COPD exacerbation in the azithromycin trial.
24121042 2014 Role of TNFRSF1B polymorphisms in the response of Crohn's disease patients to infliximab.
24076392 2013 TNF receptor 2 protects oligodendrocyte progenitor cells against oxidative stress.
24070898 2013 Progranulin directly binds to the CRD2 and CRD3 of TNFR extracellular domains.
23948613 2013 Impaired Th1 immunity in ovarian cancer patients is mediated by TNFR2+ Tregs within the tumor microenvironment.
23895422 2013 Amyloid beta???? (A???) up-regulates the expression of sortilin via the p75(NTR)/RhoA signaling pathway.
23861542 2013 Release of nonmuscle myosin II from the cytosolic domain of tumor necrosis factor receptor 2 is required for target gene expression.
23799986 2013 Maternal tumor necrosis factor receptor 2 gene variants associated with pre-eclampsia in Tunisian women.
23712715 2013 TNF, acting through inducibly expressed TNFR2, drives activation and cell cycle entry of c-Kit+ cardiac stem cells in ischemic heart disease.
23672298 2013 Serum level of soluble tumor necrosis factor receptor 2 is associated with the outcome of patients with diffuse large B-cell lymphoma treated with the R-CHOP regimen.
23619127 2013 Overexpression of TNF-? in mitochondrial diseases caused by mutations in mtDNA: evidence for signaling through its receptors on mitochondria.
23532748 2013 Levels of TNF-?, soluble TNF receptors (sTNFR1, sTNFR2), and cognition in bipolar disorder.
23408847 2013 Asymptomatic plasmodial infection is associated with increased tumor necrosis factor receptor II-expressing regulatory T cells and suppressed type 2 immune responses.
23316846 2013 Quantitative flow cytometric analysis of expression of tumor necrosis factor receptor types I and II on mononuclear cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23095497 2013 Estradiol modulates tumor necrosis factor-induced endothelial inflammation: role of tumor necrosis factor receptor 2.
23086255 2012 Tumour necrosis factor alpha and oxidative stress as maintaining factors in the evolution of anorexia nervosa.
23082052 2012 Increased tumor necrosis factor receptor 1 expression in human colorectal adenomas.
22921902 2012 The methionine 196 arginine polymorphism of the TNF receptor 2 gene (TNFRSF1B) is not associated with worse outcomes in heart failure.
22860894 2012 Genetic polymorphisms of tumour necrosis factor receptor superfamily 1b and fas ligand are associated with clinical efficacy and/or acute severe infusion reactions to infliximab in Crohn's disease.
22743059 2012 Both internalization and AIP1 association are required for tumor necrosis factor receptor 2-mediated JNK signaling.
22617158 2012 Inflammation marker and risk of pancreatic cancer: a nested case-control study within the EPIC cohort.
22573350 2012 Circulating levels of TNF receptor II are prognostic for patients with peripheral T-cell non-Hodgkin lymphoma.
22547679 2012 The tumor necrosis factor receptor stalk regions define responsiveness to soluble versus membrane-bound ligand.
22525685 2012 [TNF-? and soluble receptor TNF-? type 1 in children with diabetes mellitus type 1].
22480688 2012 LPS activates ADAM9 dependent shedding of ACE from endothelial cells.
22461090 2012 Distribution of P75 neurotrophin receptor in adult human cochlea--an immunohistochemical study.
22451321 2012 Hippocampal membrane-associated p75NTR levels are increased in Alzheimer's disease.
22342236 2012 Association analysis of TNFRSF1B polymorphism with susceptibility for migraine in the Chinese Han population.
22228740 2012 Myometrial tumor necrosis factor-? receptors increase with gestation and labor and modulate gene expression through mitogen-activated kinase and nuclear factor-?B.
22221522 2012 Genetic polymorphisms in TNFA/TNFR2 genes and Chagas disease in a Colombian endemic population.
22215119 2012 Effect of aerobic training on plasma cytokines and soluble receptors in elderly women with knee osteoarthritis, in response to acute exercise.
22110694 2011 A TNF receptor 2 selective agonist rescues human neurons from oxidative stress-induced cell death.
22068019 2011 Evaluation of serum level of tumor necrosis factor receptor II in hepatitis C virus (genotype 4)-infected middle-aged men with and without diabetes and its complications in Egypt: a pilot study.
22057614 2011 Tumor necrosis factor-receptor 2 and TROY gene expression patterns in cutaneous squamous cell carcinoma in a Tunisian population.
21995493 2011 TNFRSF1B +676 T>G polymorphism predicts survival of non-small cell lung cancer patients treated with chemoradiotherapy.
21994466 2011 Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.
21920667 2011 Tumor necrosis factor-? levels correlate with postoperative pain severity in lumbar disc hernia patients: opposite clinical effects between tumor necrosis factor receptor 1 and 2.
21895688 2012 Salivary cortisol and soluble tumor necrosis factor-? receptor II responses to multiple experimental modalities of acute pain.
21850048 2011 TNFR1 and TNFR2 regulate the extrinsic apoptotic pathway in myeloma cells by multiple mechanisms.
21849023 2011 No association of TNFRSF1B variants with type 2 diabetes in Indians of Indo-European origin.
21813066 Association of anti-CCP positivity and carriage of TNFRII susceptibility variant with anti-TNF-? response in rheumatoid arthritis.
21809341 2012 Arecoline-induced death of human leukemia K562 cells is associated with surface up-modulation of TNFR2.
21777909 2011 Association of tumor necrosis factor alpha and its receptor polymorphisms with rheumatoid arthritis in female patients.
21673044 2011 Human lymphatic filariasis: genetic polymorphism of endothelin-1 and tumor necrosis factor receptor II correlates with development of chronic disease.
21584225 2011 Lower frequency of CD62L(high) and higher frequency of TNFR2(+) Tregs are associated with inflammatory conditions in type 1 diabetic patients.
21558270 2011 NF-kappaB signal triggering and termination by tumor necrosis factor receptor 2.
21554999 2011 Polymorphism of 3'UTR region of TNFR2 coding gene and its role in clinical tuberculosis in Han Chinese pediatric population.
21523796 2011 Critical role of tumor necrosis factor receptor 1, but not 2, in hepatic stellate cell proliferation, extracellular matrix remodeling, and liver fibrogenesis.
21419569 2011 The effect of P75 on Trk receptors in neuroblastomas.
21403886 2010 Levels of salivary IFN-gamma, TNF-alfa, and TNF receptor-2 as prognostic markers in (erosive) oral lichen planus.
21393509 2011 The growth factor progranulin binds to TNF receptors and is therapeutic against inflammatory arthritis in mice.
21350240 Association of TNF?, TNFR1, and TNFR2 polymorphisms with sperm concentration and motility.
21288590 2011 Association between serum soluble TNF? receptors and renal dysfunction in type 2 diabetic patients without proteinuria.
21221075 2011 TNFR2 interposes the proliferative and NF-?B-mediated inflammatory response by podocytes to TNF-?.
21174572 2012 A positive correlation between hydrogen peroxide and soluble TNF-alpha receptor 2 early in maternal blood and at term in placenta of pregnant women with preeclampsia.
21153362 2011 TNFR2 - target for therapeutics against neurodegenerative diseases?
21153348 2011 Tumor necrosis factor-? signaling via TNFR1/p55 is deleterious whereas TNFR2/p75 signaling is protective in adult infarct myocardium.
21150695 2011 Necdin and neurotrophin receptors: interactors of relevance for neuronal resistance to oxidant stress.
20980627 2010 Elevated levels of soluble TNF receptors 1 and 2 correlate with Plasmodium falciparum parasitemia in pregnant women: potential markers for malaria-associated inflammation.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20861605 2010 Association study of tumor necrosis factor receptor type 2 M196R and toll-like receptor 2 Arg753Gln polymorphisms with acne vulgaris in a Chinese Han ethnic group.
20842464 2011 Association of the Met-196-Arg variation of human tumor necrosis factor receptor 2 (TNFR2) with paranoid schizophrenia.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20646319 2010 TNFRSF1B A1466G genotype is predictive of clinical efficacy after treatment with a definitive 5-fluorouracil/cisplatin-based chemoradiotherapy in Japanese patients with esophageal squamous cell carcinoma.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20556591 2010 TNFR 2 M196R polymorphism and acne vulgaris in Han Chinese: a case-control study.
20548340 2011 Relationship between TNFA, TNFB and TNFRII gene polymorphisms and outcome after unrelated hematopoietic cell transplantation in a Chinese population.
20516030 2010 Altered expression of TNF-alpha signaling pathway proteins in systemic lupus erythematosus.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20488723 2010 Genetic determinants of circulating levels of tumor necrosis factor receptor II and their association with TNF-RII gene polymorphisms.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20430728 2009 Tumor necrosis factor-alpha and its receptors in epithelial ovarian cancer.
20401725 2011 Association analysis of TNFR2, VDR, A2M, GSTT1, GSTM1, and ACE genes with rheumatoid arthritis in South Asians and Caucasians of East Midlands in the United Kingdom.
20395596 2010 Endothelial-specific transgenesis of TNFR2 promotes adaptive arteriogenesis and angiogenesis.
20371430 2010 Tumor necrosis factor alpha and its soluble receptors in obese children with NAFLD.
20369486 2010 [Gene polymorphism of tumor necrosis factor-alpha receptor II in 196 site and premature births in Chinese Han Population].
20305143 2010 Impact of genomic risk factors on outcome after hematopoietic stem cell transplantation for patients with chronic myeloid leukemia.
20300049 2010 Polymorphisms spanning the TNFR2 and TACE genes do not contribute towards variable anti-TNF treatment response.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20217072 2010 SNP/haplotype associations in cytokine and cytokine receptor genes and immunity to rubella vaccine.
20181891 2010 TNF activates a NF-kappaB-regulated cellular program in human CD45RA- regulatory T cells that modulates their suppressive function.
20110607 2010 Differential activation of tumor necrosis factor receptors distinguishes between brains from Alzheimer's disease and non-demented patients.
20100586 2010 Tumor necrosis factor-alpha gene polymorphisms are associated with severity of acute graft-versus-host disease following matched unrelated donor bone marrow transplantation in children: a Pediatric Blood and Marrow Transplant Consortium study.
20074459 TNFalpha and its receptors in psoriatic skin, before and after treatment with etanercept.
20045350 2010 Generation of mouse macrophages expressing membrane-bound TNF variants with selectivity for TNFR1 or TNFR2.
20038584 2010 Membrane tumor necrosis factor (TNF) induces p100 processing via TNF receptor-2 (TNFR2).
20007930 2010 A functional haplotype in the 3'untranslated region of TNFRSF1B is associated with tuberculosis in two African populations.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19900796 2010 Genetic variability in the severity and outcome of community-acquired pneumonia.
19892918 2009 Genetic risk factors for periodontitis in a Japanese population.
19846171 2010 The association of tumor necrosis factor alpha receptor 2 and tumor necrosis factor alpha with insulin resistance and the influence of adipose tissue biomarkers in humans.
19845893 2009 Plasma concentrations of TNF-alpha and its soluble receptors sTNFR1 and sTNFR2 in patients with coronary artery disease.
19839997 2009 Similar immune profile in bipolar disorder and schizophrenia: selective increase in soluble tumor necrosis factor receptor I and von Willebrand factor.
19825522 2009 Circulating levels of TNF-alpha and its soluble receptors in the plasma of patients with epithelial ovarian cancer.
19811435 2009 Single nucleotide polymorphisms in TNF-alpha, TNFR2 gene and TNF-alpha production in Asian Indians.
19801788 2009 Serum levels of TNF-alpha, TNF-alphaRI, TNF-alphaRII and IL-12 in treated rheumatoid arthritis patients.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19772798 The role of tumor necrosis factor (TNF)-alpha and TNF receptor polymorphisms in susceptibility to ankylosing spondylitis.
19738620 2009 Tumour necrosis factor gene polymorphism: a predictive factor for the development of post-transplant lymphoproliferative disease.
19692652 2009 MEK, p38, and PI-3K mediate cross talk between EGFR and TNFR in enhancing hepatocyte growth factor production from human mesenchymal stem cells.
19684152 2009 Cigarette smoking, STAT4 and TNFRSF1B polymorphisms, and systemic lupus erythematosus in a Japanese population.
19650780 2010 Plasma soluble tumour necrosis factor-alpha receptor 2 is elevated in obesity: specific contribution of visceral adiposity.
19641466 2010 Lack of association between tumour necrosis factor receptor types 1 and 2 gene polymorphism and severe acute alcoholic hepatitis.
19561157 2009 Combination of TNF-RII, CYP1A1 and GSTM1 polymorphisms and the risk of Japanese SLE: findings from the KYSS study.
19557004 2009 Possible association of tumor necrosis factor receptor 2 gene polymorphism with severe hypertension using the extreme discordant phenotype design.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19497711 2009 Assessment of 14 functional gene polymorphisms in Japanese patients with oral lichen planus: a pilot case-control study.
19473970 2009 FOXO3a regulates oxygen-responsive expression of tumor necrosis factor receptor 2 in human dermal microvascular endothelial cells.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19442614 2009 Multiple osteoporosis susceptibility genes on chromosome 1p36 in Chinese.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19421420 2009 Tumor necrosis factor receptor superfamily, member 1B haplotypes increase or decrease the risk of inflammatory bowel diseases in a New Zealand caucasian population.
19369902 Association between polymorphisms in tumor necrosis factor (TNF) and TNF receptor genes and circulating TNF, soluble TNF receptor levels, and bone mineral density in postmenopausal Korean women.
19343543 2008 Association analysis of TNFRSF1B polymorphisms with type 2 diabetes and its related traits in North India.
19339767 2009 Role of TNF-?, sTNF-R55 and sTNF-R75 in inflammation of acute exacerbations of chronic obstructive pulmonary disease.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19287455 2009 Tumor necrosis factor receptor-associated factor-1 enhances proinflammatory TNF receptor-2 signaling and modifies TNFR1-TNFR2 cooperation.
19262425 2009 Investigation of genetic variants within candidate genes of the TNFRSF1B signalling pathway on the response to anti-TNF agents in a UK cohort of rheumatoid arthritis patients.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19246939 2009 Interferon beta-1a induces tumor necrosis factor receptor 1 but decreases tumor necrosis factor receptor 2 leukocyte mRNA levels in relapsing-remitting multiple sclerosis.
19238748 2008 Tumor necrosis factor (TNF)-TNF receptor gene polymorphisms and their serum levels in Korean women with endometriosis.
19212208 2009 Does the simultaneous tumor necrosis factor receptor 2, tumor necrosis factor promoter gene polymorphism represent a higher risk for alcoholic liver disease?
19193342 2008 Multiple genetic factors in olanzapine-induced weight gain in schizophrenia patients: a cohort study.
19177266 2009 Association between ankylosing spondylitis and polymorphism of tumour necrosis factor receptor II in Taiwanese patients.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19070941 2010 Soluble TNF receptors are associated with A? metabolism and conversion to dementia in subjects with mild cognitive impairment.
19068596 2008 [Relationship between mutation at 1 573 fragment of TNF receptor II gene and keloid].
19050632 2009 Polymorphisms in innate immunity genes predispose to bacteremia and death in the medical intensive care unit.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18807256 2008 Genetic regulation of amniotic fluid TNF-alpha and soluble TNF receptor concentrations affected by race and preterm birth.
18764880 2008 Overexpression of TNF-alpha and TNFRII in invasive micropapillary carcinoma of the breast: clinicopathological correlations.
18755894 2008 Selective death of autoreactive T cells in human diabetes by TNF or TNF receptor 2 agonism.
18717726 2008 The role of IL-12 and TNF-alpha in AIDP and AMAN.
18715339 2008 Associations between cytokine/cytokine receptor single nucleotide polymorphisms and humoral immunity to measles, mumps and rubella in a Somali population.
18685868 2008 Polymorphisms of the tumor necrosis factor-alpha receptor 2 gene are associated with obesity phenotypes among 405 Caucasian nuclear families.
18679053 2008 Increased serum levels of inflammatory markers in chronic institutionalized patients with schizophrenia.
18671942 2008 Smurf2 is a TRAF2 binding protein that triggers TNF-R2 ubiquitination and TNF-R2-induced JNK activation.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18571427 2008 A potential role of TNFR gene polymorphisms in autoimmune thyroid diseases in the Tunisian population.
18565259 Influence of FCGR3A-V212F and TNFRSF1B-M196R genotypes in patients with rheumatoid arthritis treated with infliximab therapy.
18544535 2008 Oxidative stress promotes ligand-independent and enhanced ligand-dependent tumor necrosis factor receptor signaling.
18538149 2008 Racial disparity in maternal-fetal genetic epistasis in spontaneous preterm birth.
18535030 2008 Contribution of PTPN22 1858T, TNFRII 196R and HLA-shared epitope alleles with rheumatoid factor and anti-citrullinated protein antibodies to very early rheumatoid arthritis diagnosis.
18510047 2008 [Expression of tumor necrosis factor-alpha (TNF-alpha) on peritoneal fluid mononuclear cells in women with endometriosis].
18417150 2008 Simple and highly sensitive assay system for TNFR2-mediated soluble- and transmembrane-TNF activity.
18415772 Soluble tumour necrosis factor receptors sTNFR1 and sTNFR2 are produced at sites of inflammation and are markers of arthritis activity in Behçet's disease.
18385279 2008 The tumour necrosis factor receptor superfamily member 1b 676T>G polymorphism in relation to response to infliximab and adalimumab treatment and disease severity in rheumatoid arthritis.
18337349 2008 Soluble tumor necrosis factor (TNF) receptors (sTNF-R1 and -R2) in pregnant women chronically infected with Trypanosoma cruzi and their children.
18309487 2008 Can tumor necrosis factor receptor II gene 676T>G polymorphism predict the response grading to anti-TNFalpha therapy in rheumatoid arthritis?
18248655 2008 Genetic polymorphisms of tumour necrosis factor receptor superfamily 1A and 1B affect responses to infliximab in Japanese patients with Crohn's disease.
18206417 2008 Association of TNF-alpha and TNFR1 promoters and 3' UTR region of TNFR2 gene polymorphisms with genetic susceptibility to tobacco-related oral carcinoma in Asian Indians.
18173921 Polymorphism of genes related to cardiovascular disease in patients with rheumatoid arthritis.
18088549 Genetic disregulation of TNF alpha and TNF alpha type II receptors in colon cancer at the II and III stage of disease.
18083240 2008 TNF and sTNFR1/2 plasma levels in ALS patients.
18080762 2008 Cytokine levels of TGF-beta, IL-10, and sTNFalphaRII in type C chronic liver disease.
18068948 2008 Comparing Type D personality and older age as correlates of tumor necrosis factor-alpha dysregulation in chronic heart failure.
18038243 2008 Bone structural effects of variation in the TNFRSF1B gene encoding the tumor necrosis factor receptor 2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17998218 2007 Tumour necrosis factor receptor 2 (TNFRSF1B) association study in Sjögren's syndrome.
17852784 2008 TNFR gene-modified mesenchymal stem cells attenuate inflammation and cardiac dysfunction following MI.
17825894 2007 Defective T-cell activation caused by impairment of the TNF receptor 2 costimulatory pathway in common variable immunodeficiency.
17785864 2007 Interaction between transmembrane TNF and TNFR1/2 mediates the activation of monocytes by contact with T cells.
17763205 TNF receptor I polymorphism is associated with persistent palindromic rheumatism.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17634906 2007 Polymorphisms in 33 inflammatory genes and risk of myocardial infarction--a system genetics approach.
17530646 2007 TNF polymorphisms in psoriasis: association of psoriatic arthritis with the promoter polymorphism TNF*-857 independent of the PSORS1 risk allele.
17346438 Inflammation and atherosclerosis: the role of TNF and TNF receptors polymorphisms in coronary artery disease.
17331078 2007 Epistatic interactions between genomic regions containing the COL1A1 gene and genes regulating osteoclast differentiation may influence femoral neck bone mineral density.
17267158 2007 Protein and gene expression of tumour necrosis factor receptors I and II and their promoter gene polymorphisms in Alzheimer's disease.
17258924 2007 Soluble vascular cell adhesion molecule-1 is independently associated with soluble tumor necrosis factor receptor 2 in Japanese type 2 diabetic patients.
17220297 2007 Tumor necrosis factor receptor 2 signaling induces selective c-IAP1-dependent ASK1 ubiquitination and terminates mitogen-activated protein kinase signaling.
17207711 2007 Variable number of tandem repeats of TNF receptor type 2 promoter as genetic biomarker of susceptibility to develop invasive pulmonary aspergillosis.
17028114 2007 A functional M196R polymorphism of tumour necrosis factor receptor type 2 is associated with systemic lupus erythematosus: a case-control study and a meta-analysis.
17010968 2006 The shedding activity of ADAM17 is sequestered in lipid rafts.
16980123 2006 Linkage and association between CA repeat polymorphism of the TNFR2 gene and obesity phenotypes in two independent Caucasian populations.
16979382 2006 An alternatively spliced soluble TNF-alpha receptor is associated with metabolic disorders: a replication study.
16871413 2006 Tumor necrosis factor receptor 2 M196R polymorphism in rheumatoid arthritis and osteoarthritis: relationship with sTNFR2 levels and clinical features.
16732051 2006 Divergent relationships among soluble tumor necrosis factor-alpha receptors 1 and 2, insulin resistance, and endothelial function.
16732050 2006 Soluble tumor necrosis factor receptor 2 is independently associated with brachial-ankle pulse-wave velocity in nonobese Japanese type 2 diabetic patients.
16731080 2006 Multilocus interactions at maternal tumor necrosis factor-alpha, tumor necrosis factor receptors, interleukin-6 and interleukin-6 receptor genes predict spontaneous preterm labor in European-American women.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16645020 2006 An alternative spliced variant of circulating soluble tumor necrosis factor-alpha receptor-2 is paradoxically associated with insulin action.
16580225 2006 Expression of tumor necrosis factor alpha and its receptors during cellular differentiation.
16502120 2006 CA repeat polymorphism of the TNFR2 gene is not associated with bone mineral density in two independent Caucasian populations.
16282562 2005 Physical function and its response to exercise: associations with cytokine gene variation in older adults with knee osteoarthritis.
16277675 2005 Polymorphism in the tumour necrosis factor receptor II gene is associated with circulating levels of soluble tumour necrosis factor receptors in rheumatoid arthritis.
16195372 2005 TNFR1- and TNFR2-mediated signaling pathways in human kidney are cell type-specific and differentially contribute to renal injury.
16142859 2005 Anemia in rheumatoid arthritis: association with polymorphism in the tumor necrosis factor receptor I and II genes.
16003175 2005 No association with hypertension of CLCNKB and TNFRSF1B polymorphisms at a hypertension locus on chromosome 1p36.
15943902 2005 Distinct differences between TNF receptor 1- and TNF receptor 2-mediated activation of NFkappaB.
15920055 2005 A prospective study of soluble tumor necrosis factor-alpha receptor II (sTNF-RII) and risk of coronary heart disease among women with type 2 diabetes.
15886863 2005 The (CA)n polymorphism of the TNFR2 gene is associated with peak bone density in Chinese nuclear families.
15863392 2005 A functional polymorphism of the tumor necrosis factor receptor-II gene associated with the survival and relapse prediction of breast carcinoma.
15851552 2005 TNF-857T, a genetic risk marker for acute anterior uveitis.
15842589 2005 Tumor necrosis factor receptor gene polymorphisms in Crohn's disease: association with clinical phenotypes.
15805680 2005 TNFR2 gene polymorphism in coronary artery disease.
15787661 2005 Tumour necrosis factor receptors (TNFRs) in Type 2 diabetes. Analysis of soluble plasma fractions and genetic variations of TNFR2 gene in a case-control study.
15784704 2005 Impact of infliximab on serum leptin levels in patients with Crohn's disease.
15743036 2004 Genetic disregulation of gene coding tumor necrosis factor alpha receptors (TNFalpha Rs) in colorectal cancer cells.
15674653 2005 Polymorphism of interleukin-10 promoter and tumor necrosis factor receptor II in Vietnamese patients with systemic lupus erythematosus.
15657078 2005 Induction of apoptosis by TNF receptor 2 in a T-cell hybridoma is FADD dependent and blocked by caspase-8 inhibitors.
15603867 2004 Relationship between the tumor necrosis factor receptor II (TNF-RII) gene polymorphism and sTNF-RII plasma levels in healthy controls and in rheumatoid arthritis.
15585313 2005 -238 and +489 TNF-alpha along with TNF-RII gene polymorphisms associate with the diffuse phenotype in patients with Systemic Sclerosis.
15572357 2005 The Met-196 -> Arg variation of human tumor necrosis factor receptor 2 (TNFR2) affects TNF-alpha-induced apoptosis by impaired NF-kappaB signaling and target gene expression.
15555301 2004 [Potential effect of tumor necrosis factor-alpha and tumor necrosis factor receptor II gene polymorphisms on the pathogenesis of silicosis].
15526005 2004 TNF and TNFR polymorphisms in severe sepsis and septic shock: a prospective multicentre study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459750 2004 Granulocyte macrophage-colony stimulating factor and interleukin-3 increase expression of type II tumour necrosis factor receptor, increasing susceptibility to tumour necrosis factor-induced apoptosis. Control of leukaemia cell life/death switching.
15457442 2004 The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept.
15355698 2004 [Potential effect of tumor necrosis factor-alpha and its receptor II gene polymorphisms on the pathogenesis of coal worker's pneumoconiosis].
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
15274667 2004 Tumour necrosis factor-alpha receptor 1 and 2 polymorphisms in inflammatory bowel disease and their association with response to infliximab.
15252214 2004 No association between tumour necrosis factor receptor type 2 gene polymorphism and rheumatoid arthritis severity: a comparison of the extremes of phenotypes.
15212671 2004 Genetic contribution of tumor necrosis factor (TNF)-alpha gene promoter (-1031, -863 and -857) and TNF receptor 2 gene polymorphisms in endometriosis susceptibility.
15146559 2004 Promoter polymorphisms of tumor necrosis factor-alpha are associated with risk of gastric mucosa-associated lymphoid tissue lymphoma.
15142217 2004 Association of tumor necrosis factor receptor type 2 +587 gene polymorphism with severe chronic periodontitis.
15091317 2004 No genetic association between tumour necrosis factor receptor II 196R polymorphism and Japanese sporadic Alzheimer's disease.
15071724 2004 Association between TNFRSF1B polymorphisms and bone mineral density, bone loss and fracture.
15041705 2004 Transendothelial migration of myeloma cells is increased by tumor necrosis factor (TNF)-alpha via TNF receptor 2 and autocrine up-regulation of MCP-1.
15022314 2004 Tumor necrosis factor receptor II gene polymorphism and severity of rheumatoid arthritis.
15018649 2004 Complex genetic predisposition in adult and juvenile rheumatoid arthritis.
15000697 2004 Up-regulation of soluble tumor necrosis factor receptor two in plasma of HIV-seropositive individuals who use opiates.
14872483 2004 A TNFR1 genotype with a protective role in familial rheumatoid arthritis.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14728878 2003 [A study on early activation of T lymphocytes and soluble tumor necrosis factor receptor in patients with myelodysplastic syndrome].
14688526 2003 Tumour necrosis factor receptor type II 196M/R genotype correlates with circulating soluble receptor levels in normal subjects and with graft-versus-host disease after sibling allogeneic bone marrow transplantation.
14688072 2004 Identification and characterization of a novel spliced variant that encodes human soluble tumor necrosis factor receptor 2.
14651520 2004 Genetic variants in the tumor necrosis factor receptor II gene in patients with multiple sclerosis.
14565595 2003 Association analysis of bone mineral density and single nucleotide polymorphisms in two candidate genes on chromosome 1p36.
14532286 2003 A role for tumor necrosis factor receptor-2 and receptor-interacting protein in programmed necrosis and antiviral responses.
14506926 2003 Deficient expression of tumor necrosis factor receptor type 2 in the endometrium of women with endometriosis.
12960285 2003 Regulation of TCR-mediated T cell activation by TNF-RII.
12918703 2003 Serum levels of soluble TNF-alpha receptor-II (P75), circulating gammadelta T-cells and Adamantiades-Behçet's disease activity.
12882979 2003 TL1A-induced NF-kappaB activation and c-IAP2 production prevent DR3-mediated apoptosis in TF-1 cells.
12880679 2003 Tumor necrosis factor (TNF)alpha and its soluble receptor (sTNFR) p75 during acute human parvovirus B19 infection in children.
12858454 2003 Genetic background of Japanese patients with antineutrophil cytoplasmic antibody-associated vasculitis: association of HLA-DRB1*0901 with microscopic polyangiitis.
12858434 2003 No association of polymorphisms in the tumor necrosis factor receptor I and receptor II genes with disease severity in rheumatoid arthritis.
12786601 2003 Distinct regulation of cytosolic phospholipase A2 phosphorylation, translocation, proteolysis and activation by tumour necrosis factor-receptor subtypes.
12770792 2003 TNF and TNF receptor polymorphisms in Korean Behcet's disease patients.
12739039 2003 The biallelic variable number of tandem repeats of the tumor necrosis factor receptor 2 promoter in systemic lupus erythematosus.
12730509 2003 Association of polymorphisms of the tumour necrosis factor receptors I and II and rheumatoid arthritis.
12661999 2003 Tumour necrosis factor family genes in a phenotype of COPD associated with emphysema.
12651071 2003 Influence of cytokine and mannose binding protein gene polymorphisms on human T-cell leukemia virus type I (hTLV-I) provirus load in HTLV-I asymptomatic carriers.
12610797 2003 Tumor necrosis factor receptor 2 microsatellite and exon 6 polymorphisms in rheumatoid arthritis in Taiwan.
12610052 2003 Soluble tumor necrosis factor-alpha receptors in young obese subjects with normal and impaired glucose tolerance.
12601524 2003 Polymorphisms of the tumor necrosis factor receptors: no association with narcolepsy in German patients.
12559634 2003 TNF, TNF receptor type 1, and allograft inflammatory factor-1 gene polymorphisms in Japanese patients with type 1 diabetes.
12530121 2002 Elevation of serum eosinophil cationic protein, soluble tumor necrosis factor receptors and soluble intercellular adhesion molecule-1 levels in acute bronchial asthma.
12500222 2003 Elevated serum levels of the type I and type II receptors for tumor necrosis factor-alpha as predictive factors for ARF in patients with septic shock.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12371624 2002 The emerging distinct role of TNF-receptor 2 (p80) signaling in chronic inflammatory disorders.
12370298 2002 Etk/Bmx as a tumor necrosis factor receptor type 2-specific kinase: role in endothelial cell migration and angiogenesis.
12364441 2002 Plasma interleukin-8 concentrations are increased in obese subjects and related to fat mass and tumor necrosis factor-alpha system.
12353079 2002 Relationships between fibrinolytic and inflammatory parameters in human adipose tissue: strong contribution of TNFalpha receptors to PAI-1 levels.
12351485 2002 Increased plasma-soluble tumor necrosis factor-alpha receptor 2 level in lean nondiabetic offspring of type 2 diabetic subjects.
12296856 2002 Thalidomide and its analogues have distinct and opposing effects on TNF-alpha and TNFR2 during co-stimulation of both CD4(+) and CD8(+) T cells.
12233877 2002 Tumor necrosis factor-alpha receptor II polymorphism in patients from southern Europe with mild-moderate and severe rheumatoid arthritis.
12220546 Role of TNF/TNFR in autoimmunity: specific TNF receptor blockade may be advantageous to anti-TNF treatments.
12217957 2002 Linkage disequilibrium between polymorphisms in the human TNFRSF1B gene and their association with bone mass in perimenopausal women.
12209507 2002 Single-nucleotide polymorphisms in tumor necrosis factor receptor genes: definition of novel haplotypes and racial/ethnic differences.
12209506 2002 Association between tumor necrosis factor receptor II and familial, but not sporadic, rheumatoid arthritis: evidence for genetic heterogeneity.
12161545 2002 Comment: the methionine 196 arginine polymorphism in exon 6 of the TNF receptor 2 gene (TNFRSF1B) is associated with the polycystic ovary syndrome and hyperandrogenism.
12144133 Genetic disregulation of gene coding tumor necrosis factor alpha receptors (TNF alpha Rs) in follicular thyroid cancer--preliminary report.
12122509 2002 sTNF-RII: is it useful for the early diagnosis of rejection and for prognosis after renal transplantation?
12049175 2002 Pharmacogenetic investigation of the TNF/TNF-receptor system in patients with chronic active Crohn's disease treated with infliximab.
12011375 2002 Tumour necrosis factor-alpha polymorphism and the HLA-Cw*0602 allele in psoriatic arthritis.
11979305 2002 Polymorphisms in TNFA and TNFR2 affect outcome of unrelated bone marrow transplantation.
11961180 2002 Tumour necrosis factor receptor II polymorphism and juvenile idiopathic arthritis.
11907583 2002 TNF-RII and c-IAP1 mediate ubiquitination and degradation of TRAF2.
11907088 2002 Role of TNF receptor-associated factor 2 in the activation of IgM secretion by CD40 and CD120b.
11904678 2002 Polymorphisms of the TNF gene and the TNF receptor superfamily member 1B gene are associated with susceptibility to ulcerative colitis and Crohn's disease, respectively.
11882518 2002 Shedding of TNF-alpha receptors, blood pressure, and insulin sensitivity in type 2 diabetes mellitus.
11861282 2002 Increased sensitivity of T lymphocytes to tumor necrosis factor receptor 1 (TNFR1)- and TNFR2-mediated apoptosis in HIV infection: relation to expression of Bcl-2 and active caspase-8 and caspase-3.
11804591 2002 A mammalian homolog of Drosophila schnurri, KRC, regulates TNF receptor-driven responses and interacts with TRAF2.
11762942 2001 Association of tumor necrosis factor receptor type II polymorphism 196R with Systemic lupus erythematosus in the Japanese: molecular and functional analysis.
11737221 2001 Polymorphisms in the TNF-alpha and TNF-receptor genes in patients with coronary artery disease.
11600223 2001 Tumor necrosis factor receptor 2 polymorphism in systemic lupus erythematosus: no association with disease.
11520075 2001 Human milk anti-inflammatory component contents during acute mastitis.
11371414 2001 Analysis of tumor necrosis factor-alpha, lymphotoxin-alpha, tumor necrosis factor receptor II, and interleukin-6 polymorphisms in patients with idiopathic pulmonary fibrosis.
11357933 2001 Tumor necrosis factor receptor 2 gene (TNFRSF1B) in genetic basis of coronary artery disease.
11315843 2001 TNFRSF1B in genetic predisposition to clinical neuropathy and effect on HDL cholesterol and glycosylated hemoglobin in type 2 diabetes.
11285131 2001 Case-control study with narcoleptic patients and healthy controls who, like the patients, possess both HLA-DRB1*1501 and -DQB1*0602.
11279055 2001 A diverse family of proteins containing tumor necrosis factor receptor-associated factor domains.
11244088 2001 The atypical protein kinase C-interacting protein p62 is a scaffold for NF-kappaB activation by nerve growth factor.
11212177 2001 Association between rheumatoid arthritis and polymorphism of tumor necrosis factor receptor II, but not tumor necrosis factor receptor I, in Caucasians.
11197692 2000 New single nucleotide polymorphisms in the coding region of human TNFR2: association with systemic lupus erythematosus.
11169260 2001 Lack of association between the Met196Arg polymorphism in the TNFR2 gene and autoimmune diseases accompanied by vasculitis including SLE in Japanese.
11163081 2000 Tumor necrosis factor, tumor necrosis factor receptors type 1 and 2, lymphotoxin-alpha, and HLA-DRB1 gene polymorphisms in human T-cell lymphotropic virus type I associated myelopathy.
11144293 2000 Significant association of the tumor necrosis factor receptor 2 (TNFR2) gene with human narcolepsy.
11126399 2000 Tumor necrosis factor receptor-II: heritability and effect on brain morphology in schizophrenia.
11112773 2001 Caveolin-1 associates with TRAF2 to form a complex that is recruited to tumor necrosis factor receptors.
10950109 2000 The death domain of tumor necrosis factor receptor 1 is necessary but not sufficient for Golgi retention of the receptor and mediates receptor desensitization.
10848577 2000 Stat1 as a component of tumor necrosis factor alpha receptor 1-TRADD signaling complex to inhibit NF-kappaB activation.
10764746 2000 TTRAP, a novel protein that associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor-associated factors (TRAFs), and that inhibits nuclear factor-kappa B activation.
10747083 2000 Keratin-dependent, epithelial resistance to tumor necrosis factor-induced apoptosis.
10206649 1999 Structural basis for self-association and receptor recognition of human TRAF2.
9552007 1998 Differential activities of secreted lymphotoxin-alpha3 and membrane lymphotoxin-alpha1beta2 in lymphotoxin-induced inflammation: critical role of TNF receptor 1 signaling.
9535738 1998 Mutations which abolish phosphorylation of the TRAF-binding domain of TNF receptor 2 enhance receptor-mediated NF-kappa B activation.
9507943 1998 Decreased trkA neurotrophin receptor expression in the parietal cortex of patients with Alzheimer's disease.
9461607 1998 Tumor necrosis factor receptor (TNFR)-associated factor 2A (TRAF2A), a TRAF2 splice variant with an extended RING finger domain that inhibits TNFR2-mediated NF-kappaB activation.
9326234 1997 Dysregulation of membrane-bound tumor necrosis factor-alpha and tumor necrosis factor receptors on mononuclear cells in human immunodeficiency virus type 1 infection: low percentage of p75-tumor necrosis factor receptor positive cells in patients with advanced disease and high viral load.
9109395 1997 The p80 TNF receptor-associated kinase (p80TRAK) associates with residues 354-397 of the p80 cytoplasmic domain: similarity to casein kinase.
9104814 1997 TRAF-interacting protein (TRIP): a novel component of the tumor necrosis factor receptor (TNFR)- and CD30-TRAF signaling complexes that inhibits TRAF2-mediated NF-kappaB activation.
8702885 1996 Human tumor necrosis factor receptor p75/80 (CD120b) gene structure and promoter characterization.
8702708 1996 Anatomy of TRAF2. Distinct domains for nuclear factor-kappaB activation and association with tumor necrosis factor signaling proteins.
8661109 1996 Physical mapping and genomic structure of the human TNFR2 gene.
8590321 1995 Upregulation of NF-kappa B-dependent gene expression mediated by the p75 tumor necrosis factor receptor.
8123048 1994 Lymphotoxin lacks effects on 75-kDa receptors in cytotoxicity on U-937 cells.
8069916 1994 A novel family of putative signal transducers associated with the cytoplasmic domain of the 75 kDa tumor necrosis factor receptor.
8015639 1994 Purification of two types of TNF inhibitors in the urine of the patient with chronic glomerulonephritis.
7884318 1995 75- but not 55-kDa tumor necrosis factor receptor is active in the homotypic aggregation and proliferation of human lymphokine-activated T killer (T-LAK) cells in vitro.
7859281 1995 The Epstein-Barr virus transforming protein LMP1 engages signaling proteins for the tumor necrosis factor receptor family.
7821811 1994 Cloning, sequencing and partial functional characterization of the 5' region of the human p75 tumor necrosis factor receptor-encoding gene (TNF-R).
7664431 1995 Expression and functional significance of tumor necrosis factor receptors in human myocardium.
7639698 1995 Association of a RING finger protein with the cytoplasmic domain of the human type-2 tumour necrosis factor receptor.
7559483 1995 Casein kinase-1 phosphorylates the p75 tumor necrosis factor receptor and negatively regulates tumor necrosis factor signaling for apoptosis.
7544915 1995 TRAF2-mediated activation of NF-kappa B by TNF receptor 2 and CD40.
7539446 1995 Site and menstrual cycle-dependent expression of proteins of the tumour necrosis factor (TNF) receptor family, and BCL-2 oncoprotein and phase-specific production of TNF alpha in human endometrium.
2173696 1990 Purification and partial amino acid sequence analysis of two distinct tumor necrosis factor receptors from HL60 cells.
2172983 1990 A second tumor necrosis factor receptor gene product can shed a naturally occurring tumor necrosis factor inhibitor.
2166946 1990 Complementary DNA cloning of a receptor for tumor necrosis factor and demonstration of a shed form of the receptor.
2160731 1990 A receptor for tumor necrosis factor defines an unusual family of cellular and viral proteins.
2158863 1990 Molecular cloning and expression of a receptor for human tumor necrosis factor.
2153136 1990 Two tumor necrosis factor-binding proteins purified from human urine. Evidence for immunological cross-reactivity with cell surface tumor necrosis factor receptors.
1966549 1990 Two human TNF receptors have similar extracellular, but distinct intracellular, domain sequences.
1929203 1991 [Gastroduodenal reflux and non-ulcerous dyspepsia. Is it an accidental association?].
1663076 1991 Tumour necrosis factor receptor distribution in human lymphoid tissue.
1655619 1991 The gene for the type II (p75) tumor necrosis factor receptor (TNF-RII) is localized on band 1p36.2-p36.3.
1335762 1992 Down-modulation of cell surface expression of p80 form of the tumor necrosis factor receptor by human immunodeficiency virus-1 tat gene.
1328224 1992 Biochemical properties of the 75-kDa tumor necrosis factor receptor. Characterization of ligand binding, internalization, and receptor phosphorylation.