Property Summary

NCBI Gene PubMed Count 535
PubMed Score 1806.18
PubTator Score 1231.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Multiple Sclerosis 498 4.019 2.0
Primary biliary cirrhosis 45 0.0 2.0
Disease Target Count Z-score Confidence
Amyloidosis 68 3.284 1.6

Expression

  Differential Expression (16)

Disease log2 FC p
hepatocellular carcinoma 1.200 2.2e-04
pancreatic cancer 1.300 1.3e-03
glioblastoma 1.600 6.4e-03
posterior fossa group A ependymoma 1.300 5.0e-07
astrocytoma 1.500 1.0e-02
non diabetic and post-ischemic heart fai... -1.100 1.4e-03
medulloblastoma, large-cell -1.300 7.0e-04
primary pancreatic ductal adenocarcinoma 1.149 1.7e-02
lung cancer -1.600 7.2e-05
group 4 medulloblastoma -1.300 4.6e-04
pilocytic astrocytoma 1.600 9.2e-09
pancreatic carcinoma 1.300 1.3e-03
subependymal giant cell astrocytoma 1.753 5.0e-03
lung carcinoma -1.200 8.4e-17
ovarian cancer 2.200 6.9e-07
pituitary cancer -1.400 8.4e-04

 CSPA Cell Line (2)

Gene RIF (469)

PMID Text
26928194 Higher circulating sTNFR1 and sTNFR2 are associated with diabetic kidney disease, and predicts incident cardiovascular disease and mortality independently of microalbuminuria and kidney function in type 2 diabetics.
26888535 TNFR1 (and IL-6) concentrations predict risk of recurrent vascular events in recent lacunar stroke patients.
26813918 The serum levels of TNF-alpha and sTNFR I showed a significant decreasing trend after treatment in cutaneous leishmaniasis.
26777482 overexpression of sTNF-alphaR-Fc in pig islets prolongs islet xenograft survival
26755728 Following TNF-converting enzyme-mediated ectodomain shedding of TNF type I receptor (TNFR1), the membrane-bound TNFR1 C-terminal fragment is subsequently cleaved by gamma-secretase to generate a cytosolic TNFR1 intracellular domain.
26616867 data suggest that the R92Q mutation gives rise to a stronger interaction between the receptor and its ligand, which results in the potentiation of TNF-mediated pathways
26574625 Atorvastatin reduced soluble TNFR1/2 receptors in systemic lupus erythematosus.
26499922 These results suggest that CR1 induces apoptosis by activating the caspase pathway via binding to TNFR1.
26475675 The release of extracellular vesicles was triggered by TNFA from BEAS-2b cells.TNFA-triggered extracellular vesicles contained TNFR1 and TRADD.
26270730 Data show that NCI-H716 cells were immunostained for tumor necrosis factor receptor TNFR1, and TNFalpha treatment enhances glucagon-like peptide-1 (GLP-1) secretion.
26224639 Tumor necrosis factor-alpha genetic polymorphism is not a genetic risk factor for developing vitiligo.
26208457 These results support further exploring the use of TNFR1-selective inhibition in inflammatory bone loss disorders such as osteomyelitis and peri-prosthetic aseptic loosening.
26202849 The TNF-dependent mechanism requires cell surface expression of TNFR1, as this is blocked by TNFR1-specific dAb.
26183779 Tag7, can bind to the TNFR1 receptor, thereby inhibiting the cytotoxic actions of the Tag7-Hsp70 complex and TNF-alpha, an acquired immunity cytokine.
26178412 TNFRSF1A TNFRSF1A
26177311 TNFR1 and TNFR2 were significant predictors of disease progression in IgA nephropathy.
26122654 TNFR1 Regulates Ovarian Cancer Cell Tumorigenicity Through PIK3CB-p110Beta
26113409 interaction of TNFR1 with TNFR2 determines the biological characters of hypopharyngeal squamous cell carcinoma and TNFR1 may dominate this process
26083468 T. vaginalis Infection Is Associated with Increased IL-8 and TNFr1 Levels
26055088 TNFRSF1A, CASP3 and CASP8 gene variants were not associated with Achilles tendinopathies in British Caucasians.
25909160 In colon cancer patients, TNFR1 was increased. IL-32alpha increases TNFR1-adaptor complex in human colon cancer.
25889297 CXCL13 and CCL4 could act as circulating biomarkers in autoimmune hemolytic anemia (AIHA), and higher plasma soluble TNFRII might favor the diagnosis of SLE-related instead of primary AIHA.
25888769 TNFRSF1A gene mutation identified in adult onset of periodic disease.
25860248 Circulating TNF receptors 1 and 2 are associated with the severity of renal interstitial fibrosis in IgA nephropathy
25840914 Herpes simplex virus type 2-Infected monocyte-derived dendritic cells (MDDCs) produce TNF-alpha, which binds to its receptor TNF-R1 and upregulates the expression of CCR5 on cell surface, leading to enhance HIV-1 p24 release from MDDCs
25828588 serum concentrations of soluble TNFalpha and its receptors (sTNFRI and sTNFRII) in patients with rheumatoid arthritis, were evaluated.
25817730 results indicate that a TNFR1/RIPK1/P38 axis is present in adenosine-induced apoptosis of colonic cancer cells. This axis triggers apoptosis and plays crucial roles in relay of the death signaling
25783484 Markedly elevated concentrations of circulating TNFR1/2 were correlated with the occurrence of contrast-induced kidney injury.
25770168 High TNFRSF1A expression is associated with IgA nephropathy.
25749018 This study found that the mRNA expression of IL-1R1, TNFR1, and TNFR2 was significantly higher in schizophreina patients compared with normal control subjects
25744939 A family with autosomal recessive transmission of TNFR-associate periodic syndrome with a novel R104W NM_001065.3 c.397C>T; p.Arg133Trp mutation in TNFRSF1A is described.
25735143 Combinations of cytokine gene network polymorphic markers as potential predictors of myocardial infarction
25684197 polymorphisms in both TNFAIP3 and TNFRSF1A genes play a role in MS pathogenesis.
25531320 inhibition of TNFR1 or NF-kappaB activity can be expected to enhance the efficiency of approaches aimed at blocking beta-catenin-driven anoikis resistance of colon carcinoma cells
25466434 In a healthy adolescent twin cohort, heritability estimates were moderate but significant for tumor necrosis factor-receptor type 1, 0.50 (95% CI 0.11-0.63).
25461388 This review discusses both endogenous and pharmacologic inhibitors of TNFR1 signaling, and how these impact the ubiquitin system.
25443631 Sharpin deficiency sensitized primary murine keratinocytes, human keratinocytes, and mouse embryonic fibroblasts to TNF-induced apoptosis.
25416967 Data show that the interplay between the two TNF receptors (TNFR1 and TNFR2) was apparent in the expression pattern of lectin-type oxidized LDL receptor 1 (LOX-1) in response to TNF-alpha.
25351965 Soluble TNFR1 was increased in Kawasaki disease patients with pericardial effusion compared to those without.
25318944 Serum soluble tumor necrosis factor receptor 1 level is associated with the outcome of diffuse large B-cell lymphoma patients treated with the CHOP or R-CHOP regimen.
25292131 A negative correlation of p55/p75 ratio with prolactin and a positive correlations of p55/p75 ratio with insulin level and HOMAIR insulin resistance factor were found.
25288570 Dendritic cell maturation and survival are differentially regulated by TNFR1 and TNFR2.
25275127 Herpes simplex virus type 2-Infected monocyte-derived dendritic cells (MDDCs) produce TNF-alpha, which binds to its receptor TNF-R1 and upregulates the expression of CCR5 on cell surface, leading to enhance HIV-1 p24 release from MDDCs
25271196 Elderly women with low back pain had the highest sTNF-R1 plasma levels compared to elderly women with reports of other pain or no pain.
25263964 The aim of this study was to investigate whether polymorphisms of TNF-alpha (rs1800630, rs1800629) and TNFR1 (rs767455) were associated with susceptibility to and clinical outcome of rheumatoid arthritis in Chinese Han population.
25255422 sTNFR1 is associated with increased total mortality due to cancer and cardiovascular causes
25230327 PA induced the apoptosis of HUVECs by initiating the death pathway (TNF-R1/TRADD/caspases 8 pathway), whereas AA enhanced cell survival to protect vascular endothelial cells by activating the survival pathway (TNF-R1/RIP/NF-kappaB 50/NF-kappaB 65).
25229256 TNFR1 has a role in mediating TNF-alpha-induced tumour lymphangiogenesis and metastasis by modulating VEGF-C-VEGFR3 signalling
25098821 This study demonstrated that cTNFRs levels at the time of initial diagnosis could predict renal progression in patients with iMN.
25039986 Expression of tumour necrosis factor-alpha and its receptors in Hodgkin lymphoma.
25034210 Data suggest that maternal leukocytes contribute to sTNFR1 levels in plasma in association with decreasing newborn weight and preeclampsia with concomitant intrauterine growth restriction.
25010932 association of TNF-alpha, TNFRSF1A and TNFRSF1B gene polymorphisms with the risk of sporadic breast cancer
25008247 mediates generation of TNF-a-induced endothelial cells microparticles, which contribute to their apoptosis and inflammation
24980434 identified TNF-induced K63 ubiquitination of TNF-R1 mediated by the ubiquitin ligase RNF8 as an early molecular checkpoint in the regulation of the decision between cell death and survival
24965843 MEFV gene polymorphisms and TNFRSF1A mutation are susceptibility and modifier genes in Inflammatory myopathy with abundant macrophages (IMAM).
24896343 Data indicate that progranulin (PGRN) possesses multiple other actions in addition to its binding to TNF receptors (TNFR) and the inhibition of TNF-alpha/TNFR interaction.
24896334 Studies indicate that tumor necrosis factors TNF-alpha/TNF-beta and their receptor TNFR1 and TNFR2 play a regulatory role of different immune cells.
24851923 Pregnancy was associated with higher levels of soluble TNF-R1 and 2, with even higher levels in preeclampsia.
24844917 Report role of TNF-alpha/TNFR1/TNFR2 signaling system in mononuclear cells recovered from peritoneal fluid of women with endometriosis at different stages.
24805855 the prognosis of patients with diffuse large B-cell lymphoma, not otherwise specified can be more accurately identified by evaluating both TNF-alpha and TNFR1 expression.
24803721 TNFR-1 might play a role in the pathogenesis of psoriasis and can be used as a marker of the disease.
24783218 In AS patients, the levels of TNF-R1 dropped significantly when treated with either infliximab (P < 0.01) or etanercept (P < 0.001). In contrast, the levels of this receptor remained unchanged in RA patients treated with either compound.
24782596 tumor necrosis factor receptor genetic polymorphisms affect the expression levels of membrane-bound type I and type II receptors
24748490 Demonstrate the presence of soluble receptors for TNF-alpha in the synovial fluid of patients with primary knee OA and the relationship of these receptors with clinical parameters.
24746195 Dysregulation of TNF plays a role in the pathology of many auto-immune diseases. TNF-blocking agents have proven successful in the treatment of such diseases
24736233 results suggest that the ability of S. aureus to activate TNFR1 and Ca(2+)/calpain signaling contribute to T cell activation and excessive inflammation in the setting of acute pneumonia.
24708999 With patients presenting with the typical clinical picture, two patients were positive for the pR92Q/c.362G>A mutation in heterozygosity in periodic fevers.
24681099 Data indicate that cellular effects of defensin 5 involve interactions with the extra-cellular domain of tumor necrosis Factor 1.
24668260 study reveals the pleiotropic effect of a TNF receptor-associated periodic syndrome (TRAPS)-associated mutant form of TNFR1 on inflammatory signaling pathways (a proinflammatory signalome)
24623026 TNFR1 is a strong prognostic factor for all-cause mortality in type 2 diabetes with renal dysfunction, and its clinical utility is suggested in addition to established risk factors for all-cause mortality.
24587316 TNF-alpha regulates human eosinophil apoptosis via ligation of TNF-receptor 1 and balance between NF-kappaB and AP-1.
24578190 The levels of proinflammatory adaptive cytokines and shed TNF receptors are elevated prior to disease flare in systemic lupus erythematosus.
24576746 This study showed that Increased plasma levels of TNFR1 in Alzheimer's disease.
24557113 Herpes simplex virus (HSV)-mediated expression of p55TNFSR suppresses neuropathic pain induced by systemic dideoxycytidine in rats, in which the SDF1-alpha/CXCR4 system may be involved.
24511129 Our findings from two independent community-based cohorts confirm and extend results of previous studies supporting circulating sTNFRs as relevant biomarkers for kidney damage and dysfunction in elderly individuals, even in the absence of diabetes.
24497084 These results show that shTNFRI-Fc and HA-hHO-1 TG pigs generated by the F2A self-cleaving peptide express both shTNFRI-Fc and HA-hHO-1 molecules, which provides protection against oxidative and inflammatory injury
24393624 Low-penetrance TNFRSF1A variants can be associated with an autoinflammatory phenotype.
24386183 Hepatic venous levels of sTNFR-I after TIPS insertion may predict mortality in patients with severe portal hypertension.
24361886 structure-based mutations of TNFR-1 (P367A and P368A), TRADD (F266A), and RIP1 (M637A and R638A) disrupted formation of the death domain (DD) complex and prevented stable interactions among those DDs
24301904 Among Parkinson disease patients, increased sTNFR1 and sTNFR2 concentrations were associated with poorer cognitive test scores.
24174586 NO evidence that rs1800693G strongly influences clinical or radiographic indices of disease course and treatment response.
24165468 data suggest that the receptors for IL-6 and TNFalpha, rather than the cytokines themselves, may be better indicators of early vascular changes that are associated with cardiovascular diseases
24130718 The IL7R polymorphism was associated with reduced odds of multiple sclerosis attacks involving the brainstem/cerebellum as were the TNFRSF1A and IL12A polymorphisms.
24130709 The IL7R, TNFRSF1A, and GPC5 polymorphisms tended to be associated with having a second event of Multiple sclerosis within a year.
24024893 Recent work investigating the functional consequences of MS-associated genetic variation in the gene encoding TNFR1 has demonstrated that genetic risk drives the production of a novel, endogenous TNF antagonist
23975421 TNF-alpha/TNFR1 signaling promotes gastric tumorigenesis through induction of Noxo1 and Gna14 in tumor cells.
23965844 In a cohort of patients with TNF receptor-associated autoinflammatory syndrome, the most common TNFRSF1A variant was R92Q (34% of cases), followed by T50M (10%). Cysteine residues were disrupted in 27% of cases, accounting for 39% of sequence variants.
23908318 beta-Hydroxy-beta-methylbutyrate-free acid attenuated circulating TNF-alpha IP and TNFR1 expression during recovery from resistance exercise.
23894535 Data show involvement of the same TNFR1 residue in mendelian and multifactorial inflammatory disorders.
23745996 Rare mutations in TNFRSF1A are found in patients with idiopathic recurrent acute pericarditis.
23624563 Both rs1800693 and rs4149584 TNFRSF1A polymorphisms are genetic modifiers of multiple sclerosis and have functional consequences in the TNF-R1.
23620528 Data show that TNFR1 associates with CD137L and is required for CD137L reverse signaling.
23619127 TNF receptors are differentially regulated in patients' muscle in which the expression levels of TNFR1 mRNA are decreased and those of TNFR2 mRNA are increased compared with controls
23532748 Serum levels of soluble TNFR1 are upregulated in bipolar patients compared to controls.
23526964 The strong effect of circulating level of TNFR1 on risk of end stage renal disease in type 2 diabetes was not changed by including circulating levels of FGF-23.
23505244 Our study provides a new mechanism of TNFRSF1A regulation whereby three polymorphisms in the promoter, exon 1 and intron 4 have a functional and combined effect on exon 2 splicing, via a coupling mechanism between transcription and splicing.
23494522 these findings indicate that the interaction of TNF with TNFRI is pivotal for T cell migration in synovial tissue in vitro, and thereby suggest a relevant role of the cytokine for in vivo T cell trafficking to synovitic joints.
23493346 TNF receptor 1 and neuroendocrine-regulated protein signal pathways seem to play an important role in bone metastasis.
23490134 Osteoprotegerin expression is regulated by the presence or absence of TNFR1 on melanomas, and melanomas drive OPG production in the absence of accessory cells through autocrine signaling via surface expression of mTNF
23461592 TNFRSF1A p.R92Q and MEFV p.M694I mutations are associated with an autoinflammatory syndrome characterized by amyloid deposition.
23405158 High Soluble TNFR1 is associated with infarct size and ventricular dysfunction in ST-elevation myocardial infarction
23360651 Increased levels of sTNFR2 have been found in schizophrenia patients compared with healthy volunteers.
23322903 Studies indicate that the anti-apoptotic protein c-FLIP is an important regulator of death receptor signaling, including TNFR1, Fas, DR4, and DR5.
23322460 The clinical phenotype of TRAPS, associated with multiple sclerosis and rheumatoid arthritis might be associated with the TNFRSF1A D12E mutation.
23321203 In a multi-ethnic cohort, sTNFR1 was associated with all-cause and non-vascular mortality, particularly among those of a lower socioeconomic status.
23316846 Application of the protocol-identified differences in the percentage of cells that expressed TNFRs, as well as the absolute number of receptors per cell, among different subpopulations of PBMCs, and between PBMCs cultured with and without LPS.
23269568 Genetic variations in TNFRSF1A do not have role in adult onset Still's disease pathogenesis.
23207486 Serum levels of sTNF-R1 are a reliable diagnostic marker for detection of Alzheimer's disease.
23205868 Screening by maternal characteristics and serum TNF-R1 at 30-33 weeks could be effective in identifying some of the cases that will subsequently develop pre-eclampsia.
23182003 At the moment of vasovagal syncope, soluble TNFR1 serum levels drop rapidly.
23160117 sTNFR1 and sTNFR2 are more sensitive inflammatory markers than TNF-alpha in assessment of disease activity in Crohn's disease and ulcerative colitis patients.
23117241 Mutations in TNFR1 inhibit autophagy in TNFR-associated periodic syndrome, leading to accumulation of mutant TNFR1, increased NF-kB activation, increased IL-1B secretion, and chronic inflammation.
23086255 TNF-R55 was higher in anorexia nervosa patients with duration of disease longer than one year as compared to controls and patients with shorter duration. TNF-R55 inversely correlated with BMI and directly with disease duration.
23082052 The serum levels of soluble TNF-R1 (sTNF-R1) in colorectal adenoma patients were significantly higher than in the health control group.
23081800 Progenitor stimulation is selectively mediated by TNF-R1 and involves activation of caspase-8, without redundant activity of TNF-R2.
23019260 Patients with Parkinson's disease have an activated Bid-mediated destructive signal pathway via TNFRI in the temporal cortex.
22994200 In a Korean population, three SNPs in TNFRSF1A were associated with neuromyelitis optica.
22945416 TNFalpha and its soluble alpha receptors are significantly higher in infliximab-treated responders than in nonresponders.
22860894 Genetic polymorphisms of tumour necrosis factor receptor superfamily 1a ... are associated with clinical efficacy and/or acute severe infusion reactions to infliximab in Crohn's disease.
22801493 analysis of multiple sclerosis GWAS data in conjunction with the 1000 Genomes Project data, shows genetic evidence that strongly implicates SNP rs1800693 as the causal variant in the TNFRSF1A region; further functional studies show that this MS risk allele directs expression of a novel, soluble form of TNFR1 that can block TNF
22749881 Lateral dynamics of TNF-R1 before and after ligand binding, was investigated.
22675546 Optineurin despite its substantial role in vesicular trafficking, endocytosis of cell surface receptors and recruitment to the TNFR1 complex is dispensable for the 14.7K-mediated protection against TNF-induced apoptosis.
22617158 sTNF-R1 seemed to be a risk factor for pancreatic cancer in women
22609894 In chronic heart failure patients without anemia, the inflammatory state (serum TNFR1) and deterioration in iron metabolism (serum hepcidin) were the main determinants of a decrease in hemoglobin.
22568977 The high affinity associated with LT-(TNFR1)1 is due to the interaction between the CRD4 domain with LT.
22547679 the membrane-proximal extracellular stalk regions of TNFR1 and TNFR2 are crucial in controlling responsiveness to soluble TNF
22535754 The only dietary changes that were associated with 1-y changes in the geometric mean TNFR60 concentrations were those of virgin olive oil and vegetables.
22396498 The findings indicated that integrin a6b1 promotes the survival of brain endothelial cells by inhibiting prodeath signaling by TNF-R1, in part by inducing cellular FLICE inhibitory protein expression.
22343913 Data suggest that a novel mutation/amino acid substitution in TNFRSF1A gene (305G>A; C102Y) is associated with TRAPS (tumor necrosis factor receptor-associated periodic syndrome) observed in identical twin brothers and their father. [CASE REPORT]
22311714 Report presence of TNFRSF1A mutations causing tumor necrosis factor receptor-associated periodic syndrome among patients with idiopathic recurrent acute pericarditis.
22288185 Distribution of TNF-alpha polymorphisms among workers engaged in the chemical production industry is associated with methylated phenol (m-cresol) contamination and apoptosis disorders.
22281876 Mutation in MEFV R717H and mutations in TNFRSF1A IVS2-17_18del2bpCT and IVS3+30:G-->A are novel in Hispanic Chilean patients with hereditary periodic fever syndrome.
22272576 These studies confirm the weak genetic associations between ankylosing spondylitis and TNFRSF1A.
22235167 The role of costimulatory receptors of the tumour necrosis factor receptor family in atherosclerosis. (review)
22228740 The mRNA expression of both TNFR1A and TNFR1B receptors increased with advancing gestation and labor in myometrium.
22215119 Aerobic training increased the plasma concentration of sTNR1 but it decreased the sTNFR2 in elderly women with knee osteoarthritis.
22209080 Elevated urinary concentrations of IL6, sIL6R, TNFR1 and sVCAM-1 clearly indicate an early acute transplant rejection.
22115362 This review examines each proposed mechanism of TNFR1 dysfunction, and addresses how these processes might ultimately impact upon cytokine secretion and disease pathophysiology. [Review]
22059991 paper addresses issue related to potential involvement of TNF/TNFRSF1A signalling in pathophysiology of MS, its relationship to TNF receptor-associated periodic syndrome and possibility of genetic link between both disorders through the R92Q mutation
22042131 structural kidney damage in patients with type 2 diabetes is associated with TNF-alpha system activity and specifically with plasma tumor necrosis factor receptor type 1 concentrations.
22036455 Serum TNF-R1 was elevated in hypertensive patients with left ventricular hypertrophy compared to non-hypertrophy patients. Serum PIIINP was associated with Fas and TNF-R1; PINP was also associated with these cytokines.
21976655 Human cytomegalovirus pUL138 coprecipitated with tumor necrosis factor receptor 1, extended the protein half-life, and enhanced its signaling responses, thus leading to tumor necrosis factor receptor 1 hyperresponsiveness.
21930713 ST6Gal-I regulates macrophage apoptosis via alpha2-6 sialylation of the TNFR1 death receptor.
21920667 TNFR1 protein levels in nucleus pulposus positively correlate with pain scores in lumbar disc herniation.
21880774 The authors suggest that via upregulating TNFR1 surface expression human cytomegalovirus UL138 may sensitize latently infected cells to TNF-alpha-mediated reactivation of human cytomegalovirus.
21850048 The TNF-R1 receptor system adjusts the responsiveness of the extrinsic apoptotic pathway in myeloma cells by multiple mechanisms that generate a highly context-dependent net effect on myeloma cell survival.
21819445 Physical activity was significantly correlated with sTNFRI in patient with achilles tendinosis group and among tendinosis men, but not in the entire control group or among control men
21813053 Antinuclear antibodies are associated with tumor necrosis factor receptor I gene polymorphism in patients with rheumatoid arthritis.
21789618 Report higher prevalence of the -383A allele and -383AA genotype in Mexicans with ankylosing spondylitis compared with matched controls.
21602493 hypothesize that p300 and DAPK-1 represent nodes where the inflammatory networks of IL-32 and IL-17 overlap, and that these proteins would affect both TNF-R1-dependent and -independent pathways
21567205 TNFRSF1A R92Q mutation is a common finding, thus possilby a risk factor in Argentinean multiple sclerosis patients.
21565411 In a study population of multiple sclerosis patients and controls, a milder TNF receptor-associated periodic syndrome (TRAPS) mutation (R92Q in the TNFRSF1A gene) has been suggested as a risk factor for multiple sclerosis.
21555518 TNFRSF1A is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21552549 association of single nucleotide polymorphisms to multiple sclerosis
21523796 There is a critical role of tumor necrosis factor receptor 1, but not 2, in hepatic stellate cell proliferation, extracellular matrix remodeling, and liver fibrogenesis.
21420073 Although all six TNFRSF1A mutations show enhance NF-kappa B activity, different mutations stimulate distinct NF-kappa B family subunit activitites, reulting in the gereation of unique cytokine secretory profiles.
21393509 study reports that PGRN bound directly to tumor necrosis factor receptors and disturbed the TNFalpha-TNFR interaction
21385537 No support found for an association of TNFRS1A mutations and Behcet's disease in Israel for Arabs and Jews.
21350240 No significant associations were found between TNFalpha -857C-->T and TNFR2 676T-->G polymorphisms and semen quality. TNFR1 36A allele is associated with increased sperm concentration and motility, supporting the significance of TNFR1 gene in semen quality
21321109 A model predicts that TNF-alphaR1 internalization plays a critical role in infection control within a granuloma, controlling whether there is bacterial clearance, inflammation, containment of bacteria within the granuloma, or uncontrolled bacterial growth.
21316985 TNF-alpha levels linked with pulmonary hemorrhagic implications of leptospirosis, while elevated sTNFR1 and IL-10 levels linked with fatal cases
21315128 genetic polymorphism is associated with Kawasaki disease in Chinese individuals
21288590 The higher levels of sTNFR1 and sTNFR2 were associated with a greater decline in eGFR in type 2 diabetic patients without proteinuria, especially in diabetic women.
21284530 Discusses the role of MEFV and TNFRS1a in the initiation of heart involvement in pericardial diseases [review]
21256825 the L-domain of IGFBP-5 is a novel TNFR1 ligand that functions as a competitive TNF-alpha inhibitor.
21225694 The majority of children with an R92Q mutation of the TNFRSFA1 gene show a milder disease course than that in children with TNFRSFA1 structural mutations and have a high rate of spontaneous resolution and amelioration of the recurrent fever episodes.
21153368 signaling and function of TNFR1 in the liver
21153367 Compartmentalization of TNF-receptor 1 signaling: TNF-R1-associated caspase-8 mediates activation of acid sphingomyelinase in late endosomes
21153350 Functional consequences of disease-associated mutations in TNFR1 elucidated by transcriptome analysis
21132303 Elevation of IL-15, sIL2-R and sTNF-R1 in active patients provides preliminary evidence for the activation of inflammatory response during PM/DM flares.
21124859 Results support that deleterious copy number alterations in MVK, NLRP3 and TNFRSF1A are rare or absent from the mutational spectrum of hereditary recurrent fevers.
21113948 missense mutation V20A associated with tumor necrosis factor receptor-associated periodic syndrome (TRAPS) presenting with periodic gastrointestinal symptoms
21068102 results demonstrate for the first time that genetic polymorphisms in STAT3, TNFRSF1A and 2p15 are associated with ankylosing spondylitis in Han Chinese, suggesting common pathogenic mechanisms for the disease in Chinese and Caucasian European populations.
21068102 Observational study of gene-disease association. (HuGE Navigator)
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21037509 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21029567 A low-penetrance mutation may be associated with isolated recurrent pericarditis.
20980627 Both soluble TNF receptors 1 and 2 are significantly increased in the peripheral blood of women with asymptomatic malaria, are positively correlated with parasitemia, and are predictive of placental malaria-associated low-birth-weight babies.
20955203 Staphylococcus aureus exerts pro-inflammatory stimuli on keratinocytes through the production of staphylococcal protein A signalling through TNF RI.
20930310 Abnormal activation of TNF-alpha signaling system, represented by increased expression of sTNFR1, is associated with a higher risk of progression from mild cognitive impairment to Alzheimer disease.
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20695192 Myometrium conversion into leiomyoma and an increase in its mass is accompanied by changes in the expression and contents TNF and TNF RI.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20654748 Observational study of gene-disease association. (HuGE Navigator)
20646338 TNFR1 mRNA expression level and TNF receptor 1 gene polymorphisms are predictive markers for susceptibility to develop invasive pulmonary aspergillosis.
20646338 Observational study of gene-disease association. (HuGE Navigator)
20635912 lower percentages of positive leukocytes in patients with pulmonary tuberculosis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20566746 Data suggest that TNF, acting through TNFR2, is an autocrine growth factor for ccRCC acting via Etk-VEGFR2 cross-talk, insights that may provide a more effective therapeutic approach to this disease.
20564232 Data suggest a role for NM IIB in TNFR1 endocytosis and the formation of the death inducing signaling complex (DISC).
20532935 A novel TNFRSF1 gene mutation in a Turkish family with TNF receptor-associated periodic syndrome.
20516030 TNFR1 and TNFR2 expression was negatively correlated with disease activity in patients with systemic lupus erythematosus.
20511226 both NF-kappaB and SAPK activation appear independent of both TNFR1 localization to low density membrane domains and to TNF-induced receptor internalization
20506103 The overall frequency of R92Q in patients with familial Mediterranean fever was 3.2%, not significantly different from the control group.
20506103 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20497634 Familial clustering has been recently reported in up to 10% of patients with recurrent pericarditis, thus suggesting in some cases a possible genetic predisposition
20483718 lupus serum IgG causes skin injury by involving the TNFR1 signaling pathway and monocyte differentiation to dendritic cells
20458742 These findings suggest that TNF-R1, TRUSS, and TRPC4 augment Ca(2+) loading of endoplasmic reticulum Ca(2+) stores in the context of m1AchR stimulation
20457915 show that mutant TNFR1 accumulates intracellularly in peripheral blood mononuclear cells of TNFR-associated periodic syndrome patients
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20446090 This study demonistrated that higher sTNFR1 levels were found in bipolar disorder patients.
20430728 Results suggest that tissue expression of TNF-R2, but not TNF-R1, in epithelial ovarian cancer was correlated with the highest risk of cancer progression, and that TNF-alpha may therefore play a role in disease progression.
20430450 Study reinforces a role for CD6 and TNFRSF1A as risk loci for multiple sclerosis, extending to populations of southern European ancestry.
20430450 Observational study of gene-disease association. (HuGE Navigator)
20422457 Single-nucleotide polymorphisms in TNFRSF1A gene is associated with early-stage non-small-cell lung cancer.
20421368 TNFR1 polymorphisms associate with aging-related coronary artery disease in humans.
20400394 A novel missense mutation in tumour necrosis factor receptor superfamily 1A (TNFRSF1A) gene found in tumour necrosis factor receptor-associated periodic syndrome (TRAPS) with high serum interleukin (IL)-22.
20371430 Serum concentrations of TNFalpha and its receptors, TNFR1, were significantly higher in obese children with NAFLD compared to controls.
20333651 TNF-alpha induces MMP-9 expression via the TNFR1/TRAF2/PKCalpha-dependent JNK1/2/c-Jun and c-Src/EGFR/PI3K/Akt pathways.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20110607 This study demonstrated that TNFRI levels are increased whereas TNFRII levels are decreased in the brains of patient with alzheimer disease compared to non-demented brains
20100586 Observational study of gene-disease association. (HuGE Navigator)
20098615 Observational study of gene-disease association. (HuGE Navigator)
20074469 A poor response to colchicine treatment and/or a steroid-dependence may be the clue to investigate TNFRSF1A mutations in patients with idiopathic recurrent pericarditis.
20074469 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20074459 Etanercept reduced TNF, TNF-RI and TNF-RII immunostaining in lesional and non-lesional skin samples of psoriasis patients.
20066156 findings that human Tregs preferentially express receptors for TNF and IL-1 suggest a potential function in sensing and dampening local inflammation
20062090 assessment of TNFR1 levels before and on day 7 after nonmyeloablative hematopoietic stem cell transplant provided useful information on subsequent risk of experiencing acute graft vs host disease
20045350 Macrophages that expressed tmTNF mutants with selectivity for either TNFR1 or TNRF2 as a tool to evaluate signaling through these receptors, were generated.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19892918 Observational study of gene-disease association. (HuGE Navigator)
19890662 Observational study of gene-disease association. (HuGE Navigator)
19879354 The cysteine rich domain (CRD) 1 of TNF receptor type 1 is directly involved in stabilization of ligand/receptor signalling complexes via homophilic receptor/receptor interactions.
19879194 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19865102 Observational study of gene-disease association. (HuGE Navigator)
19854717 The region on chromosome 16 that has been replicated is interesting as the highly plausible candidate gene, tumour necrosis factor receptor type 1 (TNFR1)-associated death domain (TRADD), is located between rs9033 and rs868213.
19845893 Metabolic syndrome and diabetes are associated with higher plasma concentrations of TNF-alpha and its receptors.
19826638 TNFR1 is strongly expressed in the EC109 cell line and may play an apoptosis-mediating role, which may be suppressed by highly activated NF-kappaB
19825522 The results of the present study suggested that preoperative plasma TNF-alpha and sTNF-Rs levels in epithelial ovarian cancer patients correlated with the highest risk of cancer progression.
19804406 Two unrelated Turkish children with similar clinical phenotypes and laboratory findings related with autoinflammatory disorders and with novel p. Y331X mutation in TNFRSF1A gene, are presented.
19801788 TNF-alphaRI and TNF- alphaRII serum concentrations are more important and better predictive factors than TNF-alpha in rheumatoid arthritis course and in the active forms of the disease.
19796978 Mutations may lead to inflammatory joint disease.
19794511 A genome-wide association study has identified the R92Q variant of the TNFRSF1A gene as a new susceptibility locus for multiple sclerosis.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19784808 Data show that inhibition of NFAT3 activation by shNFAT3 significantly downregulated tumor necrosis factor (TNF)-alpha induction, its receptor TNFR1, caspase 10, caspase 3, and poly (ADP-ribose) polymerase.
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19772798 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19741298 Data suggest that chronic production of TNF-alpha in the tumor microenvironment increases myeloid cell recruitment in a TNFR1 and IL-17-dependent manner that contributes to the tumor-promoting action of this proinflammatory cytokine.
19738620 Observational study of gene-disease association. (HuGE Navigator)
19701605 sTNFR-1 (an early inflammatory marker) was higher in community dwelling versus institutionalized elderly in the 60-70 age range.
19692652 TNFR1 acts to decrease basal TGF-alpha and TNF-alpha-stimulated hepatocyte growth factor in human bone marrow mesenchymal stem cells.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690440 The surface expression levels of TNFR1 on granulocytes were upregulated in patients with myeloperoxidase anti-neutrophil cytoplasmic autoantibody-associated vasculitis.
19673872 Our case indicates the existence of TNFRSF1A gene mutations without typical clinical tumor necrosis factor receptor-associated periodic syndrome (TRAPS) phenotypes, TRAPS phenotypes without associated TNFRSF1A mutations, and incomplete penetrance of TRAPS
19643942 TNFR-1(tumor necrosis factor receptor type I ) and osteoprotegrin were both related to disease stage and exacerbations.
19641466 These results did not support an association between 36 TNFR1, 676 TNFR2 gene polymorphisms and acute alcoholic hepatitis.
19641466 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19594495 study found no evidence of somatic mutations in the death domain of TNF-R1 in gastric, colorectal, breast, liver or lung cancers or acute myelogenous leukemias
19582456 These data suggest that -383A>C TNFRI polymorphism is not a susceptibility marker in rheumatiod arthritis.
19579027 Report TNFRSF1A mutations in PFAPA, a periodic fever disease, of unknown etiology, characterized by aphthous stomatitis, pharyngitis and cervical adenitis.
19556827 +36 A/G substitutions in the TNF-alpha death receptor gene could not be considered as an important genetic factor in susceptibility to glaucoma.
19556827 Observational study of gene-disease association. (HuGE Navigator)
19541728 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19525953 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19525953 Replication in an independent set of 2,215 subjects with multiple sclerosis (MS) and 2,116 control subjects validates new MS susceptibility loci at TNFRSF1A, IRF8 and CD6; TNFRSF1A harbors two independent susceptibility alleles.
19523687 Results suggest that the C/EBPalpha and C/EBPbeta transcription factors enhance expression of the TNFR1 protein in cells.
19505916 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19448410 CD40 signaling inhibits the proliferation of CD40-positive lung cancer cells through mTNF-alpha/TNFRI in vitro.
19390575 Observational study of gene-disease association. (HuGE Navigator)
19390513 sTNFR1, but not hsCRP nor IL-6, is independently associated with increased LV mass. Chronic subclinical inflammation including the TNFR1-associated system may contribute to left ventricular hypertrophy.
19369902 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19339767 TNF alpha receptor level in induced sputum positively correlated with lung function
19336370 Observational study of gene-disease association. (HuGE Navigator)
19287455 TRAF1 shifts the quality of integrated TNFR1-TNFR2 signaling from apoptosis induction to proinflammatory NFkappaB signaling.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19246939 Due to different signal transduction properties of both receptors in the natural course of multiple sclerosis, TNF-alpha signaling in leukocytes via TNF-R1 might be beneficial, but detrimental via proinflammatory TNF-R2.
19242924 In preeclampsia, first trimester increased serum levels of MMP-9 and TNF-R1 suggest the presence of an underlying inflammatory process; MMP-9 is not useful in the prediction of preterm delivery.
19238748 Observational study of gene-disease association. (HuGE Navigator)
19193342 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19116900 periodic syndrome-associated TNFRI mutants induce the expression of multiple genes encoding inflammatory molecules, cellular receptors, transcription factors, and regulators of apoptosis in endothelial cells
19084540 The results suggested that R31A and R32G mutations strongly influenced electrostatic interaction with TNFR2, and that L29K mutation contributed to the binding of R1-6 to TNFR1.
19077906 Enhanced expression of TNF-R1 and Fas receptors (CD95, APO-1)on the apoptotic hepatocytes suggest that both may be involved in the pathogenesis of FHF and seem to be potential therapeutic target.
19070941 Patients with mild cognitive impairment who subsequently developed Alzheimer's disease or vascular dementia already had higher levels of soluble TNFR1 in both CSF and plasma at baseline when compared to age-matched controls.
19029521 In most cases with MS and coexisting TRAPS, features of MS were quite typical, whereas TRAPS presented mostly without the fever episodes observed in childhood. The penetrance of the R92Q mutation in affected family members was higher than reported.
19019335 Observational study of gene-disease association. (HuGE Navigator)
18990758 Observational study of gene-disease association. (HuGE Navigator)
18936101 Alix and ALG-2 are new actors of the TNF-R1 pathway
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18807256 amniotic fluid TNF-alpha and soluble TNF receptor concentration regulation is affected by race and preterm birth
18807256 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18717726 An upregulated TNFR2-dependent plays a role in acute-phase motor axonal neuropathy.
18715339 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18679053 Serum levels of sTNFR1 and sTNFR2 were increased in schizophrenic patients when compared with controls (all p < 0.05), but there was no difference in TNF-alpha levels.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18625701 both the constitutive and cAMP-induced release of TNFR1 exosome-like vesicles occur via PKA-dependent pathways that are regulated by the anchoring of RIIbeta to BIG2 via AKAP domains B and C
18606683 study shows that TNFR1 associates with Jak2, c-Src, and PI3K in various cell types to engage signaling pathways, activate transcription factors, and modulate gene expression
18571427 data showed that TNFRI polymorphisms have an important role in auimmune thyroid disease pathogenesis in both familial and case-control samples
18571427 Observational study of gene-disease association. (HuGE Navigator)
18544535 oxidative stress promotes TNFR receptor (TNFR1- and TNFR2) self-interaction and ligand-independent and enhanced ligand-dependent TNF signaling
18541194 Increases in TNFR1( tumor necrosis factor receptor type 1) level at day 7 post allogeneic hematopoietic cell transplant correlated with the severity of GVHD and survival in pediatric patients
18538149 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18512793 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
18510047 Higher percentage of peritoneal fluid macrophages expressing TNFR1 and TNFR2 proteins in endometriosis suggests dependence of these cells on TNF-alpha stimulation.
18508832 soluble tumour necrosis factor-alpha receptor 1 is decreased in obstructive sleep apnoea patients treated with nasal continuous positive airway pressure
18445477 This identifies RBMX as an ARTS-1-associated protein that regulates both the constitutive release of TNFR1 exosome-like vesicles and the inducible proteolytic cleavage of TNFR1 ectodomains.
18415772 sTNFR1 and sTNFR2 were found at increased plasma concentrations in active Behcet's disease (BD), with the highest concentration in active BD with arthritis.
18408954 Report expands the spectrum of TNFRSF1A mutations associated with TRAPS, adding further evidence for possible additive effects of a low-penetration R92Q and cysteine residue mutations, and confirms etanercept as an efficacious treatment alternative.
18338763 Our findings also suggest that polymorphisms at IL23R and TNFRSF1A, and possibly HLA and TLR4, loci may account for phenotypic variation in IBD.
18338763 Observational study of gene-disease association. (HuGE Navigator)
18337349 The circulating levels of sTNF-R1 increased in non-transmitting and transmitting mothers and in Trypanosoma cruzi-infected and non-infected neonates.
18333356 In patients with heart failure, increased sTNFR-1 as an expression of chronic inflammation is correlated with both anemia and low serum lipid fractions.
18287568 Wer report a TNFRSF1A R92Q mutation in association with a multiple sclerosis-like demyelinating syndrome.
18275007 amniotic fluid sTNF-R1 levels did not differ significantly before and after labor
18248655 These results suggest that tumour necrosis factor receptor genotypes may be involved in the different responses to infliximab in Japanese patients with Crohn's disease.
18248655 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18243134 Therefore, our results suggest that TNFR1 -329G/T polymorphism may play an important role in the development of HCC.
18206417 TNF-alpha-308 G/A may be related to susceptibility, whereas -609 TT TNFR1 and 1690 C/T TNFR2 SNPs may be protective to tobacco-related oral squamous cell carcinoma.
18206417 Observational study of gene-disease association. (HuGE Navigator)
18180277 TNFRSF1A sequencing disclosed a novel V173D/p.Val202Asp substitution encoded by exon 6 in one family, the c.194-14G>A splice variant in another and the R92Q/p.Arg121Gln substitution in two families.
18174230 Observational study of gene-disease association. (HuGE Navigator)
18167350 TNFR1 accumulated at the chlamydial inclusion and was shed by the infected cell into the culture supernatant. Receptor shedding depended on the infection-induced activation of the MEK-ERK pathway and the metalloproteinase TACE
18163488 High levels of TNFRI at the cell surface in patients with the C73R mutation hypersensitizes cells to stimulation by TNF, leading to increased NF-kappaB p65 subunit activation and an exaggerated proinflammatory response
18086728 A novel, TRAPS causing, TNFRSF1A splice site mutation is associated with decreased sTNFR1 levels, cell surface and whole cell extract expression and increased NF-kappaB transcription factor activation
18083240 The increase of plasma TNF-alpha in amyotrophic lateral sclerosis (ALS) patients in the presence of a slight increase of sTNFR-1 & -2 supports a functionally significant activation of the TNF system in ALS.
18078813 Thus, a distinct population of TNFR1 exosome-like vesicles circulate in human plasma and may modulate TNF-mediated inflammation.
18068948 Data show that Type D personality is associated with substantially increased TNFR1 and TNF-alpha activity.
18058462 Downregulation of survivin causes changes in mitosis and apoptosis, which may be related to changes in TNF receptors and NF-kappaB signaling.
17921876 As TNF-R1 is increased in substantia nigra of Parkinsonian brains, nonvesiculated DA might also play a role in inducing TNF-R1 expression and predispose the neuron to the action of cytokines released in a microglia-mediated inflammatory response.
17852084 Value of serum TNFR1 concentration as a marker of response to phototherapy may depend on duration of skin lesions and the treatment method.
17785864 Transmembrane tumor necrosis factor (TNF) and TNF receptor (TNFR)1/2 are interaction partners contributing to TNF-alpha production in monocytes.
17763205 Observational study of gene-disease association. (HuGE Navigator)
17763205 association between persistent palindromic rheumatism and SNPs within the TNFRSF1A gene.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17693606 odds ratios obtained (0.64 for multiple sclerosis and 0.91 for Wegener's granulomatosis ) do not indicate a significant association of the R92Q allele with these diseases
17688691 No increase in TNF receptor I gene or protein expression was observed in degenerate or herniated intervertebral discs.
17686637 Observational study of gene-disease association. (HuGE Navigator)
17686637 The result suggests that pregnancy failure is associated with an increase of soluble TNFR1.
17665448 Observational study of gene-disease association. (HuGE Navigator)
17665435 TNFRSF1A with the C33Y mutation has an abnormal structure in leukocytes of patients with TNFR-associated periodic syndrome.
17564788 Periodic fever syndrome is associated with Tumor necrosis factor receptor-1A mutation C30R (cysteine to arginine) in a Japanese family.
17530646 Observational study of gene-disease association. (HuGE Navigator)
17477815 Observational study of gene-disease association. (HuGE Navigator)
17431682 Observational study of gene-disease association. (HuGE Navigator)
17431682 analyzed candidate genes related to TNFalpha regulation and found that interleukin (IL)-10, interferon-gamma receptor 1 (IFNGR1), and TNFalpha receptor 1 (TNFR1) genes were linked and associated to both tuberculosis and TNFalpha
17346438 Observational study of gene-disease association. (HuGE Navigator)
17324927 TNFR-1 mediated apoptosis is stimulated by a dominant negative functional domain on DAPK-1
17267158 TNF-RI and -RII promoter gene polymorphisms and variations in protein and gene expression of these receptors are unlikely to play a major role in the development of Alzheimer's disease
17234651 TNFRSF1A investigation in rheumatoid arthritis from the French Caucasian population showed only the R92Q mutation, with a frequency of 4.5%, but no evidence for linkage to the disease
17200772 Observational study of gene-disease association. (HuGE Navigator)
17200772 association between TNFRSF1A +36G/G genotype and the MetS renders obese women more prone to activation of the TNF pathway reflected by high circulating sTNFR1 and PAI-1 levels.
17105909 Observational study of gene-disease association. (HuGE Navigator)
17105909 These results suggest that genetic variations in the TNF-alpha gene and its receptor genes may not be involved in individual vulnerability to METH dependence.
17075277 Serum levels of soluble TNFRSF1A, measured along with the C-reactive protein level, may be a useful screening marker for differentiating tumor necrosis factor receptor-associated periodic syndrome from systemic juvenile idiopathic arthritis.
17051333 These findings suggest that EMAP-II sensitises endothelial cells to apoptosis by facilitating TNF-R1 apoptotic signalling via TRADD mobilization.
16859822 Abundant tumor necrosis factor receptor 1 (mTNFR1) expression was observed in the cytotrophoblast cells and chorionic villus stromal cells in women with spontaneous abortion.
16732051 inversely related to endothelium-dependent vaodilation in glucose intolerance.
16731080 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16580225 tumor necrosis factor alpha and TNFR1 and TNFR2 have roles in cellular differentiation
16533817 APN/CD13 regulates TNFalpha-induced apoptosis via inhibition of TNFRI shedding
16463024 Observational study of gene-disease association. (HuGE Navigator)
16463024 TNFRSF1A is a modulation in Cystic Fibrosis.
16447098 TNF-receptor-associated periodic syndrome is caused by mutations in the gene encoding TNFRSF1A on chromosome 12p13. (Review)
16282562 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16277675 Observational study of gene-disease association. (HuGE Navigator)
16260783 TAK1 is recruited to the TNF-R1 complex via RIP and likely cooperates with MEKK3 to activate NF-kappaB in TNF-alpha signaling
16234278 Observational study of gene-disease association. (HuGE Navigator)
16227624 PAK4 has a role in TNF-alpha induced cell survival pathyways by facilitating TRADD binding to the TNF Receptor
16216134 This review presents the tumor necrosis factor receptor (TNFR)-associated periodic syndrome (TRAPS) as an autosomal dominant, multisystemic, autoinflammatory disorder caused by mutations in the TNFR1 gene (TNFRSF1A)
16195372 TNFR1 and TNFR2 have roles in cell type-specific renal injury
16153798 Observational study of gene-disease association. (HuGE Navigator)
16142859 Observational study of gene-disease association. (HuGE Navigator)
16142859 Polymorphism within TNFRSF1A genes are associated with iron deficient anemia in patient diagnosed with rheumatoid arthritis.
16134057 phosphorylation of CREB is increased by 8-bromo-cAMP, which has opposite effects on TNF and TNFR1 mRNA expression
16043808 Patients with CRPS and mechanical hyperalgesia had higher levels of sTNF-RI compared with those with CRPS with identical clinical appearance but without hyperalgesia.
16043718 disabled TNFR1 function by inducing allosteric modulation of tryptophan-107 in the receptor. The allosteric effect operates by means of an allosteric cavity found a short distance from a previously identified loop involved in ligand binding.
15943902 TNFR2 and TNFR1 signal transduction mechanisms involved in activation of NFkappaB and CMV promoter-enhancer were compared with respect to their susceptibility towards inhibitors of intracellular signaling.
15857508 Herpes simplex virus type 2-Infected monocyte-derived dendritic cells (MDDCs) produce TNF-alpha, which binds to its receptor TNF-R1 and upregulates the expression of CCR5 on cell surface, leading to enhance HIV-1 p24 release from MDDCs
15851552 Observational study of gene-disease association. (HuGE Navigator)
15851552 Genetic variations in these proinflammatory mediators and their receptors appear to influence the susceptibility and severity of the inflammatory response within the eyes of patients during the development of IAU(idiopathic acute anterior uveitis).
15842589 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15818692 The C43S TNFRSF1A mutation results in decreased TNFalpha-induced nuclear signaling and apoptosis.
15817701 TNFR1 signaling pathway via sphingomyelinase may play a role as an important regulator of T cell responses
15787661 Observational study of gene-disease association. (HuGE Navigator)
15692984 Observational study of gene-disease association. (HuGE Navigator)
15586174 Observational study of genotype prevalence. (HuGE Navigator)
15586174 High frequency of TNFRSF1A polymorphism is associated with Sickle Cell Anemia
15542843 activation of p38 MAPK and c-Jun N-terminal kinase pathways by hepatitis B virus X protein mediates apoptosis via induction of Fas/FasL and TNFR1/TNFa expression
15526005 Observational study of gene-disease association. (HuGE Navigator)
15502938 Although ischemic liver injury was not serious, due to the short ischemia time, TNFR1 and TRAIL are associated with liver ischemic injury in live-donor liver transplantation but Fas is not.
15492850 Observational study of genotype prevalence. (HuGE Navigator)
15492850 Two amino acid substitutions may be associated with chronic inflammatory disorders, such as SLE, or not.
15485837 NAK is a component of the TNFalpha.TNFR1 signaling complex and has a physiological role in the TNFalpha-mediated response
15457442 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15301860 Observational study of genotype prevalence. (HuGE Navigator)
15289829 CpG islands are found within the promoter regions of both human and mouse TNFR1 (TNFRSF1) genes
15288471 Provided that TNF-R1 mediates the cytotoxic actions of TNFalpha, these results support the concept of dysregulated TNF alpha metabolism in alcoholic hepatitis.
15274667 Observational study of gene-disease association. (HuGE Navigator)
15251454 human tumour necrosis factor receptor 1 has a major region controlling cell surface expression
15188372 relatively small number of genes may be involved in the clinical manifestation of hyperimmunoglobulinemia D, with low-penetrance TNFRSF1A variants possibly influencing the phenotype
15146559 Observational study of gene-disease association. (HuGE Navigator)
15071491 Observational study of gene-disease association. (HuGE Navigator)
15063762 Observational study of gene-disease association. (HuGE Navigator)
15041705 Expression of TNF-receptor 2 (TNF-R2) but not TNF-receptor 1 (TNF-R1) was detected in myeloma cell lines.
15018649 Observational study of gene-disease association. (HuGE Navigator)
14872483 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14872483 Distribution of the TNFR2 196 R/R and TNFR1 +36 A/A genotypes in familial rheumatoid arthritis could suggest an interaction between TNFR1 and TNFR2 in the genetic susceptibility for rheumatoid arthritis.
14728878 The level of the sTNF-R1 was elevated in myelodysplastic syndrome(MDS) patients.
14694358 Observational study of gene-disease association. (HuGE Navigator)
14694358 carriers of the 92Q allele may be at increased risk of atherosclerosis
14671137 Epstein-Barr virus (EBV) immediate-early protein BZLF1 prevents TNF-alpha activation of target genes and TNF-alpha-induced cell death by down regulating TNF-R1
14610673 Tumour necrosis factor receptor-associated periodic syndrome (TRAPS) is a dominantly inherited disorder characterised by recurrent episodes of sustained fever.Here we report a case of TRAPS with a novel TNFRSF1A mutation, C70S, in a Japanese family.
13130484 genetic basis among patients with "TRAPS-like" features is heterogeneous and TNFRSF1A mutations are not commonly associated with nonfamilial recurrent fevers of unknown etiology.
12913922 preferential induction of prodestructive and proinflammatory mediators in rheumatoid arthritis synovial fibroblasts by the TNF-R55
12887920 TNFR1-induced apoptosis involves two sequential signaling complexes.
12887914 TNFR1 signals both cell survival and apoptosis.
12879482 High levels of the soluble, 55-kilodalton isoform of tumor necrosis factor receptor in bone marrow are correlated with the clinical outcome of children with acute lymphoblastic leukemia in first recurrence
12858434 Observational study of gene-disease association. (HuGE Navigator)
12858434 Neither the +36 TNFRSF1A SNP nor the +196 TNFRSF1B SNP is associated with RA severity in a population of Caucasian patients with RA.
12832748 Missense mutations found in these genes are probably responsible for an improvement in function.
12818408 (-308) TNF-alpha gene polymorphism may contribute to CHD risk in patients with type 2 diabetes and can be useful predictive marker for the diagnosis of CHD in type 2 diabetic women.
12811828 During leukocyte differentiation, time windows exist during which autocrine TNFalpha is active and then down-regulated by TNF receptor I, which may temper continuous up-regulation of synthesis of proteins involved in pericellular proteolysis.
12786601 TNFR1 stimulates cytosolic phospholipase A2 (cPLA2) with distinct signaling mechanisms, by activating mitogen-activated protein kinase (MAPK) and p38MAPK, then phosphorylating and activating cPLA2 in a MAPK-dependent fashion.
12768019 HCMV infection of fully permissive differentiated monocytic cell lines and U373 cells resulted in a reduction in cell surface expression of TNFRI and thus inhibition of TNFalpha signaling
12748171 type 1 tumor necrosis factor receptor shedding aminopeptidase regulator(ARTS-1) promotes shedding of two cytokine receptor superfamilies, type I cytokine receptor superfamily (interleukin-6Ralpha) and tumor necrosis factor receptor superfamily (TNFR1)
12730509 Observational study of gene-disease association. (HuGE Navigator)
12706861 TNFR1 apoptotic function is regulated by SODD/BAG4
12690082 plasma leptin levels, rather than nonesterified fatty acids and tumor necrosis factor receptor 1, may play a significant role in the development of hyperinsulinemia and insulin resistance in children
12661999 Observational study of gene-disease association. (HuGE Navigator)
12651071 Observational study of gene-disease association. (HuGE Navigator)
12644782 TNFR1 promoter polymorphisms are not associated with hereditary, familial, or idiopathic chronic pancreatitis
12610052 Plasma sTNFR1 and sTNFR2 were inversely related to insulin sensitivity and might contribute to the development of insulin resistance in glucose-intolerant subjects.
12601524 Observational study of gene-disease association. (HuGE Navigator)
12601524 Polymorphism not associated with narcolepsy.
12559634 Observational study of gene-disease association. (HuGE Navigator)
12559634 TNFR1 gene region might be a susceptible locus to type 1 diabetes in Japanese. Aberrant expresison or function of the receptor could be involved in the development of the disease.
12530121 serum levels elevated in asthmatic patients during acute attack
12500222 Elevated serum levels of soluble TNF-alpha receptor type I are strongly associated with the development of acute renal failure in patients with septic shock.
12391233 The role of TNF-R55 in the signaling pathway of neutral sphingomyelinase activation is enhanced by the interaction of RACK1 and FAN.
12376300 Increased sTNFRs-p55 levels in the serum and ascitic fluid reflect abnormal immune status of the patients with HCC and help predict the development of tumor.
12353079 Both adipose tissue and blood PAI-1 levels were positively associated with TNFRSF1A and TNFRSF1B in obesity.
12220546 Review. p55TNFR is required for secondary lymphoid organ architecture & optimal antibody responses to T-dependent antigens. It has an enhancing role in antigen-specific T4 cell priming.
12209523 TNFRSF1A mutations were found in 28(7.1%) of 394 unrelated patients with tumor necrosis factor receptor-associated syndrome who have recurrent inflammatory syndromes.
12209507 Observational study of gene-disease association. (HuGE Navigator)
12147741 candidate genes that may be involved in the origination of ameloblastoma and several genes previously unidentified in relation to human tooth development.
12107724 Impaired glucose tolerance is not associated with increased serum concentrations.
12105243 Observational study of gene-disease association. (HuGE Navigator)
12105243 mutation spectrum in genes in patients suffering from AA amyloidosis and recurrent inflammatory attacks
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12049175 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12017295 Altered signaling of TNFalpha-TNFR1 and SODD/BAG4 is responsible for radioresistance in human HT-R15 cells.
11961180 Observational study of gene-disease association. (HuGE Navigator)
11947900 Soluble TNF-alpha receptor I is an extracellular domain of TNFRI and antagonizes activities of TNF-alpha. Local transfection of the sTNFRI gene may have potential therapeutic value in vascular diseases in which TNF-alpha is also usually highly expressed.
11937569 Amino acid sequences located within an appropriately folded and functionally active death domain of the TNF receptor CD120a are both necessary and sufficient to promote the localization of the receptor to lipid rafts.
11934887 The human papillomavirus 16 E6 protein binds to tumor necrosis factor (TNF) R1 and protects cells from TNF-induced apoptosis
11920568 Autoimmune thyroid disease induced by thyroglobulin and lipopolysaccharide is inhibited by soluble TNF receptor type I.
11904678 Observational study of gene-disease association. (HuGE Navigator)
11882518 insulin resistance and blood pressure are linked to altered shedding of TNF-alpha receptors in type 2 diabetes mellitus
11861282 induced marked apoptosis in T cells from HIV-infected persons; associated with both alteration of Bcl-2 expression and activation of caspase-8 and caspase-3
11737221 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
11676596 Here we report the expression and purification of the human TNF-RI DD as a fusion with the Escherichia coli thioredoxin A (TRX) protein
11598334 Observational study of gene-disease association. (HuGE Navigator)
11562425 Despite the presence of functional TNFR2, TNFR1 associated with MAPK-dependent and -independent pathways is the primary signaling pathway involved in TNF alpha-induced synthetic functions in ASM cells.
11528523 Observational study of genotype prevalence. (HuGE Navigator)
11522182 Herpes simplex virus type 2-Infected monocyte-derived dendritic cells (MDDCs) produce TNF-alpha, which binds to its receptor TNF-R1 and upregulates the expression of CCR5 on cell surface, leading to enhance HIV-1 p24 release from MDDCs
11212177 Observational study of gene-disease association. (HuGE Navigator)
11196686 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11163081 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11072751 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYN      1 - 70
DCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENL     71 - 140
FQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT    141 - 210
TVLLPLVIFFGLCLLSLLFIGLMYRYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFT    211 - 280
PTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQS    281 - 350
LDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL    351 - 420
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR                                       421 - 455
//

Text Mined References (537)

PMID Year Title
26928194 2016 Association of soluble tumor necrosis factor receptors 1 and 2 with nephropathy, cardiovascular events, and total mortality in type 2 diabetes.
26888535 2016 Inflammatory Markers and Outcomes After Lacunar Stroke: Levels of Inflammatory Markers in Treatment of Stroke Study.
26813918 2016 Tumour Necrosis Factor-alpha (TNF-?) and its soluble receptor type 1 (sTNFR I) in human active and healed leishmaniases.
26777482 2016 Beneficial effects of the transgenic expression of human sTNF-?R-Fc and HO-1 on pig-to-mouse islet xenograft survival.
26755728 2016 ?-Secretase Activity Is Required for Regulated Intramembrane Proteolysis of Tumor Necrosis Factor (TNF) Receptor 1 and TNF-mediated Pro-apoptotic Signaling.
26616867 2015 Molecular dynamics and intracellular signaling of the TNF-R1 with the R92Q mutation.
26574625 Atorvastatin reduced soluble receptors of TNF-alpha in systemic lupus erythematosus.
26499922 2015 Inhibitory effect of carbonyl reductase 1 on ovarian cancer growth via tumor necrosis factor receptor signaling.
26475675 2015 TNF? triggers release of extracellular vesicles containing TNFR1 and TRADD, which can modulate TNF? responses of the parental cells.
26270730 2015 Chronic Exposure to TNF? Impairs Secretion of Glucagon-Like Peptide-1.
26224639 2015 The association between tumor necrosis factor-?-308 G/A polymorphism and risk for vitiligo: a meta-analysis.
26208457 2015 Selective inhibition of TNFR1 reduces osteoclast numbers and is differentiated from anti-TNF in a LPS-driven model of inflammatory bone loss.
26202849 2015 Tumour necrosis factor receptor I blockade shows that TNF-dependent and TNF-independent mechanisms synergise in TNF receptor associated periodic syndrome.
26183779 2015 Tag7 (PGLYRP1) in Complex with Hsp70 Induces Alternative Cytotoxic Processes in Tumor Cells via TNFR1 Receptor.
26178412 2015 Specificity of human anti-variable heavy (VH ) chain autoantibodies and impact on the design and clinical testing of a VH domain antibody antagonist of tumour necrosis factor-? receptor 1.
26177311 2015 Circulating Tumor Necrosis Factor ? Receptors Predict the Outcomes of Human IgA Nephropathy: A Prospective Cohort Study.
26122654 2015 TNFR1 Regulates Ovarian Cancer Cell Tumorigenicity Through PIK3CB-p110Beta.
26113409 2015 Interaction between TNFR1 and TNFR2 dominates the clinicopathologic features of human hypopharyneal carcinoma.
26083468 2015 T. vaginalis Infection Is Associated with Increased IL-8 and TNFr1 Levels but with the Absence of CD38 and HLADR Activation in the Cervix of ESN.
26055088 2015 Variation within three apoptosis associated genes as potential risk factors for Achilles tendinopathy in a British based case-control cohort.
25911380 2015 The seventh zinc finger motif of A20 is required for the suppression of TNF-?-induced apoptosis.
25909160 2015 IL-32? suppresses colorectal cancer development via TNFR1-mediated death signaling.
25889297 2015 CXCL13, CCL4, and sTNFR as circulating inflammatory cytokine markers in primary and SLE-related autoimmune hemolytic anemia.
25888769 2015 The novel S59P mutation in the TNFRSF1A gene identified in an adult onset TNF receptor associated periodic syndrome (TRAPS) constitutively activates NF-?B pathway.
25860248 2015 Circulating TNF receptors 1 and 2 are associated with the severity of renal interstitial fibrosis in IgA nephropathy.
25828588 2015 Expression of TNF? membrane-bound receptors in the peripheral blood mononuclear cells (PMBC) in rheumatoid arthritis patients.
25817730 2015 Adenosine induces apoptosis through TNFR1/RIPK1/P38 axis in colon cancer cells.
25816133 2015 Tumor necrosis factor disrupts claudin-5 endothelial tight junction barriers in two distinct NF-?B-dependent phases.
25783484 2015 Circulating tumour necrosis factor receptors 1 and 2 predict contrast-induced nephropathy and progressive renal dysfunction: a prospective cohort study.
25770168 2015 Altered monocyte expression and expansion of non-classical monocyte subset in IgA nephropathy patients.
25749018 2015 Proinflammatory cytokines and their membrane-bound receptors are altered in the lymphocytes of schizophrenia patients.
25744939 2015 Autosomal recessive transmission of TRAPS in a family with a novel TNFRSF1A mutation.
25735143 2014 [Combinations of cytokine gene network polymorphic markers as potential predictors of myocardial infarction].
25684197 2015 Association of TNFAIP3 and TNFRSF1A variation with multiple sclerosis in a German case-control cohort.
25531320 2015 Anoikis of colon carcinoma cells triggered by ?-catenin loss can be enhanced by tumor necrosis factor receptor 1 antagonists.
25466434 2015 Heritability of Transforming Growth Factor-?1 and Tumor Necrosis Factor-Receptor Type 1 Expression and Vitamin D Levels in Healthy Adolescent Twins.
25461388 2014 TNFR1-activated NF-?B signal transduction: regulation by the ubiquitin/proteasome system.
25443631 2014 Sharpin prevents skin inflammation by inhibiting TNFR1-induced keratinocyte apoptosis.
25416967 2015 Differential pro-inflammatory responses of TNF-? receptors (TNFR1 and TNFR2) on LOX-1 signalling.
25351965 2015 Acute pericardial effusion representing the TNF-?-mediated severe inflammation but not the coronary artery outcome of Kawasaki disease.
25318944 2014 Serum soluble tumor necrosis factor receptor 1 level is associated with the outcome of diffuse large B-cell lymphoma patients treated with the CHOP or R-CHOP regimen.
25292131 2014 The interaction between menstrual cycle, Tumour Necrosis Factor alpha receptors and sex hormones in healthy non-obese women--results from an observational study.
25288570 2014 Dendritic cell maturation and survival are differentially regulated by TNFR1 and TNFR2.
25271196 2015 Functional performance and plasma cytokine levels in elderly women with and without low back pain.
25263964 2014 Polymorphisms in the TNF-?, TNFR1 gene and risk of rheumatoid arthritis in Chinese Han population.
25255422 2014 Soluble tumor necrosis factor receptor 1 (sTNFR1) is associated with increased total mortality due to cancer and cardiovascular causes - findings from two community based cohorts of elderly.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25230327 2015 Life and death of human vascular endothelial cells by stimulation with free fatty acids through death receptors.
25229256 2014 TNFR1 mediates TNF-?-induced tumour lymphangiogenesis and metastasis by modulating VEGF-C-VEGFR3 signalling.
25098821 2014 Circulating TNF receptors are significant prognostic biomarkers for idiopathic membranous nephropathy.
25039986 2014 Expression of tumour necrosis factor-? and its receptors in Hodgkin lymphoma.
25034210 2015 Differential regulation of TNF receptors in maternal leukocytes is associated with severe preterm preeclampsia.
25010932 2014 Association of TNF-?, TNFRSF1A and TNFRSF1B gene polymorphisms with the risk of sporadic breast cancer in northeast Chinese Han women.
25008247 2014 Role of tumour necrosis factor receptor-1 and nuclear factor-?B in production of TNF-?-induced pro-inflammatory microparticles in endothelial cells.
24980434 2014 Cell fate decisions regulated by K63 ubiquitination of tumor necrosis factor receptor 1.
24965843 2014 MEFV gene polymorphisms and TNFRSF1A mutation in patients with inflammatory myopathy with abundant macrophages.
24896343 2014 Three TNFR-binding domains of PGRN act independently in inhibition of TNF-alpha binding and activity.
24896334 2014 TNF/TNFR: drug target for autoimmune diseases and immune-mediated inflammatory diseases.
24851923 2014 Soluble endoglin, transforming growth factor-Beta 1 and soluble tumor necrosis factor alpha receptors in different clinical manifestations of preeclampsia.
24844917 2015 Behavior of tumor necrosis factor-? and tumor necrosis factor receptor 1/tumor necrosis factor receptor 2 system in mononuclear cells recovered from peritoneal fluid of women with endometriosis at different stages.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24805855 2014 TNF-? receptor 1 expression predicts poor prognosis of diffuse large B-cell lymphoma, not otherwise specified.
24803721 2014 Assessment of lipocalin 2, clusterin, soluble tumor necrosis factor receptor-1, interleukin-6, homocysteine, and uric acid levels in patients with psoriasis.
24783218 2014 Ankylosing spondylitis and rheumatoid arthritis: serum levels of TNF-? and Its soluble receptors during the course of therapy with etanercept and infliximab.
24782596 2014 Polymorphisms in the tumor necrosis factor receptor genes affect the expression levels of membrane-bound type I and type II receptors.
24748490 2014 Soluble TNF receptors are produced at sites of inflammation and are inversely associated with self-reported symptoms (WOMAC) in knee osteoarthritis.
24746195 2014 Regulation and dysregulation of tumor necrosis factor receptor-1.
24736233 2014 Secretion of IL-16 through TNFR1 and calpain-caspase signaling contributes to MRSA pneumonia.
24708999 Periodic fevers in adult Greeks: clinical and molecular presentation.
24681099 2014 Functional intersection of Human Defensin 5 with the TNF receptor pathway.
24668260 2014 A pro-inflammatory signalome is constitutively activated by C33Y mutant TNF receptor 1 in TNF receptor-associated periodic syndrome (TRAPS).
24623026 2014 Association of serum concentration of TNFR1 with all-cause mortality in patients with type 2 diabetes and chronic kidney disease: follow-up of the SURDIAGENE Cohort.
24587316 2014 Tumour necrosis factor-? regulates human eosinophil apoptosis via ligation of TNF-receptor 1 and balance between NF-?B and AP-1.
24578190 2014 Proinflammatory adaptive cytokine and shed tumor necrosis factor receptor levels are elevated preceding systemic lupus erythematosus disease flare.
24576746 2014 Increased plasma levels of BDNF and inflammatory markers in Alzheimer's disease.
24557113 2014 Mechanical allodynia induced by nucleoside reverse transcriptase inhibitor is suppressed by p55TNFSR mediated by herpes simplex virus vector through the SDF1?/CXCR4 system in rats.
24511129 2014 Soluble TNF receptors and kidney dysfunction in the elderly.
24497084 2014 Production and characterization of soluble human TNFRI-Fc and human HO-1(HMOX1) transgenic pigs by using the F2A peptide.
24440909 2014 A novel role for the apoptosis inhibitor ARC in suppressing TNF?-induced regulated necrosis.
24393624 2014 The expanding spectrum of low-penetrance TNFRSF1A gene variants in adults presenting with recurrent inflammatory attacks: clinical manifestations and long-term follow-up.
24386183 2013 Soluble TNF-alpha-receptors I are prognostic markers in TIPS-treated patients with cirrhosis and portal hypertension.
24361886 2014 Death domain complex of the TNFR-1, TRADD, and RIP1 proteins for death-inducing signaling.
24301904 2014 Plasma levels of soluble tumor necrosis factor receptors are associated with cognitive performance in Parkinson's disease.
24174586 2013 Clinical relevance and functional consequences of the TNFRSF1A multiple sclerosis locus.
24165468 2013 Soluble TNF and IL-6 receptors: indicators of vascular health in women without cardiovascular disease.
24130718 2013 Association of multiple sclerosis susceptibility variants and early attack location in the CNS.
24130709 2013 Multiple sclerosis susceptibility genes: associations with relapse severity and recovery.
24070898 2013 Progranulin directly binds to the CRD2 and CRD3 of TNFR extracellular domains.
24024893 2013 A clinical conundrum: the detrimental effect of TNF antagonists in multiple sclerosis.
23975421 2014 TNF-?/TNFR1 signaling promotes gastric tumorigenesis through induction of Noxo1 and Gna14 in tumor cells.
23965844 2014 The phenotype of TNF receptor-associated autoinflammatory syndrome (TRAPS) at presentation: a series of 158 cases from the Eurofever/EUROTRAPS international registry.
23908318 2013 ?-Hydroxy-?-methylbutyrate (HMB)-free acid attenuates circulating TNF-? and TNFR1 expression postresistance exercise.
23894535 2013 Involvement of the same TNFR1 residue in mendelian and multifactorial inflammatory disorders.
23745996 2013 Expanding spectrum of TNFRSF1A gene mutations among patients with idiopathic recurrent acute pericarditis.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23624563 2013 TNFRSF1A polymorphisms rs1800693 and rs4149584 in patients with multiple sclerosis.
23620528 2013 Tumor necrosis factor receptor 1 associates with CD137 ligand and mediates its reverse signaling.
23619127 2013 Overexpression of TNF-? in mitochondrial diseases caused by mutations in mtDNA: evidence for signaling through its receptors on mitochondria.
23532748 2013 Levels of TNF-?, soluble TNF receptors (sTNFR1, sTNFR2), and cognition in bipolar disorder.
23526964 2013 Risk of ESRD and all cause mortality in type 2 diabetes according to circulating levels of FGF-23 and TNFR1.
23505244 2014 Identification of a new exon 2-skipped TNFR1 transcript: regulation by three functional polymorphisms of the TNFR-associated periodic syndrome (TRAPS) gene.
23494522 2013 Tumor necrosis factor receptor type I expression of CD4+ T cells in rheumatoid arthritis enables them to follow tumor necrosis factor gradients into the rheumatoid synovium.
23493346 2013 Elevated TNFR1 and serotonin in bone metastasis are correlated with poor survival following bone metastasis diagnosis for both carcinoma and sarcoma primary tumors.
23490134 2013 Differential expression and tumor necrosis factor-mediated regulation of TNFRSF11b/osteoprotegerin production by human melanomas.
23461592 2013 Systemic AA amyloidosis as a unique manifestation of a combined mutation of TNFRSF1A and MEFV genes.
23405158 2013 Soluble TNF receptors are associated with infarct size and ventricular dysfunction in ST-elevation myocardial infarction.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23360651 2013 Circulating levels of sTNFR1 as a marker of severe clinical course in schizophrenia.
23322903 2013 The FLIP Side of Life.
23322460 2013 Symptoms related to tumor necrosis factor receptor 1-associated periodic syndrome, multiple sclerosis, and severe rheumatoid arthritis in patients carrying the TNF receptor superfamily 1A D12E/p.Asp41Glu mutation.
23321203 2013 Tumour necrosis factor receptor 1 and mortality in a multi-ethnic cohort: the Northern Manhattan Study.
23316846 2013 Quantitative flow cytometric analysis of expression of tumor necrosis factor receptor types I and II on mononuclear cells.
23269568 2013 The association of TNFRSF1A gene and MEFV gene mutations with adult onset Still's disease.
23207486 2013 Immune profiling in blood identifies sTNF-R1 performing comparably well as biomarker panels for classification of Alzheimer's disease patients.
23205868 2013 Maternal serum tumour necrosis factor receptor 1 (TNF-R1) at 30-33 weeks in the prediction of preeclampsia.
23182003 2013 Serum concentrations of nitric oxide and soluble tumor necrosis factor receptor 1 (sTNFR1) in vasovagal syncope: effect of orthostatic challenge.
23160117 2012 TNF-? and soluble forms of TNF receptors 1 and 2 in the serum of patients with Crohn's disease and ulcerative colitis.
23117241 2013 Autophagy contributes to inflammation in patients with TNFR-associated periodic syndrome (TRAPS).
23086255 2012 Tumour necrosis factor alpha and oxidative stress as maintaining factors in the evolution of anorexia nervosa.
23082052 2012 Increased tumor necrosis factor receptor 1 expression in human colorectal adenomas.
23081800 2013 TNF-? has tropic rather than apoptotic activity in human hematopoietic progenitors: involvement of TNF receptor-1 and caspase-8.
23019260 2012 Bid signal pathway components are identified in the temporal cortex with Parkinson disease.
22994200 2013 Associations of CD6, TNFRSF1A and IRF8 polymorphisms with risk of inflammatory demyelinating diseases.
22945416 2013 A randomized controlled trial of the tumor necrosis factor antagonist infliximab for treatment-resistant depression: the role of baseline inflammatory biomarkers.
22860894 2012 Genetic polymorphisms of tumour necrosis factor receptor superfamily 1b and fas ligand are associated with clinical efficacy and/or acute severe infusion reactions to infliximab in Crohn's disease.
22817896 2012 The RIP1/RIP3 necrosome forms a functional amyloid signaling complex required for programmed necrosis.
22801493 2012 TNF receptor 1 genetic risk mirrors outcome of anti-TNF therapy in multiple sclerosis.
22749881 2012 TNF-? influences the lateral dynamics of TNF receptor I in living cells.
22675546 2012 E3-14.7K is recruited to TNF-receptor 1 and blocks TNF cytolysis independent from interaction with optineurin.
22617158 2012 Inflammation marker and risk of pancreatic cancer: a nested case-control study within the EPIC cohort.
22609894 2012 Soluble TNF? receptor type I and hepcidin as determinants of development of anemia in the long-term follow-up of heart failure patients.
22568977 2012 Are different stoichiometries feasible for complexes between lymphotoxin-alpha and tumor necrosis factor receptor 1?
22547679 2012 The tumor necrosis factor receptor stalk regions define responsiveness to soluble versus membrane-bound ligand.
22535754 2012 The Mediterranean diet pattern and its main components are associated with lower plasma concentrations of tumor necrosis factor receptor 60 in patients at high risk for cardiovascular disease.
22396498 2012 Endothelial expression of TNF receptor-1 generates a proapoptotic signal inhibited by integrin ?6?1 in glioblastoma.
22343913 2013 Tumor necrosis factor receptor-associated periodic syndrome as a cause of recurrent abdominal pain in identical twins and description of a novel mutation of the TNFRSF1A gene.
22311714 2012 Clues to detect tumor necrosis factor receptor-associated periodic syndrome (TRAPS) among patients with idiopathic recurrent acute pericarditis: results of a multicentre study.
22288185 2011 [Polymorphism of TNF gene and CPOX gene in chemical industry workers].
22281876 2012 Clinical and genetic features of hereditary periodic fever syndromes in Hispanic patients: the Chilean experience.
22272576 Evidence of genetic association between TNFRSF1A encoding the p55 tumour necrosis factor receptor, and ankylosing spondylitis in UK Caucasians.
22235167 2012 The role of costimulatory receptors of the tumour necrosis factor receptor family in atherosclerosis.
22228740 2012 Myometrial tumor necrosis factor-? receptors increase with gestation and labor and modulate gene expression through mitogen-activated kinase and nuclear factor-?B.
22215119 2012 Effect of aerobic training on plasma cytokines and soluble receptors in elderly women with knee osteoarthritis, in response to acute exercise.
22209080 2012 Elevated urinary sVCAM-1, IL6, sIL6R and TNFR1 concentrations indicate acute kidney transplant rejection in the first 2 weeks after transplantation.
22115362 2012 Tumour necrosis factor receptor trafficking dysfunction opens the TRAPS door to pro-inflammatory cytokine secretion.
22059991 2011 Role of tumour necrosis factor (TNF)-? and TNFRSF1A R92Q mutation in the pathogenesis of TNF receptor-associated periodic syndrome and multiple sclerosis.
22042131 2012 Structural damage in diabetic nephropathy is associated with TNF-? system activity.
22036455 2012 [Relationship between myocardial modelling and diastolic function in patients with essential hypertension].
22028622 2011 Smac mimetic bypasses apoptosis resistance in FADD- or caspase-8-deficient cells by priming for tumor necrosis factor ?-induced necroptosis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21976655 2011 The cytomegaloviral protein pUL138 acts as potentiator of tumor necrosis factor (TNF) receptor 1 surface density to enhance ULb'-encoded modulation of TNF-? signaling.
21930713 2011 ST6Gal-I regulates macrophage apoptosis via ?2-6 sialylation of the TNFR1 death receptor.
21920667 2011 Tumor necrosis factor-? levels correlate with postoperative pain severity in lumbar disc hernia patients: opposite clinical effects between tumor necrosis factor receptor 1 and 2.
21880774 2011 The latency-associated UL138 gene product of human cytomegalovirus sensitizes cells to tumor necrosis factor alpha (TNF-alpha) signaling by upregulating TNF-alpha receptor 1 cell surface expression.
21850048 2011 TNFR1 and TNFR2 regulate the extrinsic apoptotic pathway in myeloma cells by multiple mechanisms.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21819445 2011 Physical activity level in Achilles tendinosis is associated with blood levels of pain-related factors: a pilot study.
21813053 Antinuclear antibodies are associated with tumor necrosis factor receptor I gene polymorphism in patients with rheumatoid arthritis.
21789618 2012 -383 A/C tumor necrosis factor receptor 1 polymorphism and ankylosing spondylitis in Mexicans: a preliminary study.
21602493 2011 Inflammatory cytokines IL-32 and IL-17 have common signaling intermediates despite differential dependence on TNF-receptor 1.
21567205 2012 TNFRSF1A [corrected] R92Q mutation, autoinflammatory symptoms and multiple sclerosis in a cohort from Argentina.
21565411 2011 TNFRSF1A coding variants in multiple sclerosis.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21552549 2011 The genetic association of variants in CD6, TNFRSF1A and IRF8 to multiple sclerosis: a multicenter case-control study.
21523796 2011 Critical role of tumor necrosis factor receptor 1, but not 2, in hepatic stellate cell proliferation, extracellular matrix remodeling, and liver fibrogenesis.
21420073 2011 Differential cytokine secretion results from p65 and c-Rel NF-?B subunit signaling in peripheral blood mononuclear cells of TNF receptor-associated periodic syndrome patients.
21410936 2011 Signal pathways in astrocytes activated by cross-talk between of astrocytes and mast cells through CD40-CD40L.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
21393509 2011 The growth factor progranulin binds to TNF receptors and is therapeutic against inflammatory arthritis in mice.
21385537 MEFV, TNFRSF1A and CARD15 mutation analysis in Behçet's disease.
21350240 Association of TNF?, TNFR1, and TNFR2 polymorphisms with sperm concentration and motility.
21321109 2011 Multiscale computational modeling reveals a critical role for TNF-? receptor 1 dynamics in tuberculosis granuloma formation.
21316985 2011 Serum TNF-?, sTNFR1, IL-6, IL-8 and IL-10 levels in Weil's syndrome.
21315128 2011 A regulatory polymorphism in promoter region of TNFR1 gene is associated with Kawasaki disease in Chinese individuals.
21288590 2011 Association between serum soluble TNF? receptors and renal dysfunction in type 2 diabetic patients without proteinuria.
21284530 2011 Autoinflammatory diseases and cardiovascular manifestations.
21256825 2011 Insulin-like growth factor-binding protein-5 (IGFBP-5) inhibits TNF-?-induced NF-?B activity by binding to TNFR1.
21225694 2011 Long-term clinical profile of children with the low-penetrance R92Q mutation of the TNFRSF1A gene.
21153368 2011 TNF/TNF receptor 1-mediated apoptosis in hepatocytes.
21153367 2011 Compartmentalization of TNF-receptor 1 signaling: TNF-R1-associated caspase-8 mediates activation of acid sphingomyelinase in late endosomes.
21153350 2011 Functional consequences of disease-associated mutations in TNFR1 elucidated by transcriptome analysis.
21132303 2012 Serum concentration of interleukin 15, interleukin 2 receptor and TNF receptor in patients with polymyositis and dermatomyositis: correlation to disease activity.
21124859 2010 Combined mutation and rearrangement screening by quantitative PCR high-resolution melting: is it relevant for hereditary recurrent Fever genes?
21113948 2011 Missense mutation V20A in the tumor necrosis factor receptor superfamily 1A (TNFRSF1A) gene is associated with tumor necrosis factor receptor-associated periodic syndrome (TRAPS) presenting with periodic gastrointestinal symptoms.
21068102 2011 Association of STAT3 and TNFRSF1A with ankylosing spondylitis in Han Chinese.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21037509 2010 Variants of ADAMTS1 modify the effectiveness of statins in reducing the risk of myocardial infarction.
21029567 Recurrent pericarditis caused by a rare mutation in the TNFRSF1A gene and with excellent response to anakinra treatment.
20980627 2010 Elevated levels of soluble TNF receptors 1 and 2 correlate with Plasmodium falciparum parasitemia in pregnant women: potential markers for malaria-associated inflammation.
20955203 2011 TNF receptor I on human keratinocytes is a binding partner for staphylococcal protein A resulting in the activation of NF kappa B, AP-1, and downstream gene transcription.
20930310 2010 Higher serum sTNFR1 level predicts conversion from mild cognitive impairment to Alzheimer's disease.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20695192 2010 [Tumor necrosis factor in uterine leiomyomas at various stages of tumor growth].
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20654748 2010 High-density polymorphisms analysis of 23 candidate genes for association with bone mineral density.
20646338 TNFR1 mRNA expression level and TNFR1 gene polymorphisms are predictive markers for susceptibility to develop invasive pulmonary aspergillosis.
20635912 2009 Potential for immunotherapy with heat-killed Mycobacterium vaccae in respiratory medicine.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20566746 2010 Tumor necrosis factor receptor expression and signaling in renal cell carcinoma.
20564232 2010 Non-muscle myosin IIB helps mediate TNF cell death signaling independent of actomyosin contractility (AMC).
20532935 2013 A novel TNFRSF1 gene mutation in a Turkish family: a report of three cases.
20516030 2010 Altered expression of TNF-alpha signaling pathway proteins in systemic lupus erythematosus.
20511226 2010 Targeting of tumor necrosis factor receptor 1 to low density plasma membrane domains in human endothelial cells.
20506103 2010 Role of the R92Q TNFRSF1A mutation in patients with familial Mediterranean fever.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20497634 Familial clustering of recurrent pericarditis may disclose tumour necrosis factor receptor-associated periodic syndrome.
20483718 2010 Lupus serum IgG induces skin inflammation through the TNFR1 signaling pathway.
20458742 2010 TRUSS, TNF-R1, and TRPC ion channels synergistically reverse endoplasmic reticulum Ca2+ storage reduction in response to m1 muscarinic acetylcholine receptor signaling.
20457915 2010 Concerted action of wild-type and mutant TNF receptors enhances inflammation in TNF receptor 1-associated periodic fever syndrome.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20446090 2011 Increased plasma levels of soluble TNF receptor I in patients with bipolar disorder.
20430728 2009 Tumor necrosis factor-alpha and its receptors in epithelial ovarian cancer.
20430450 2010 Validation of the CD6 and TNFRSF1A loci as risk factors for multiple sclerosis in Spain.
20422457 2010 Polymorphisms in apoptosis-related genes and survival of patients with early-stage non-small-cell lung cancer.
20421368 2010 Aging-related atherosclerosis is exacerbated by arterial expression of tumor necrosis factor receptor-1: evidence from mouse models and human association studies.
20400394 A novel missense mutation in tumour necrosis factor receptor superfamily 1A (TNFRSF1A) gene found in tumour necrosis factor receptor-associated periodic syndrome (TRAPS) with high serum interleukin (IL)-22.
20371430 2010 Tumor necrosis factor alpha and its soluble receptors in obese children with NAFLD.
20333651 2010 TNF-alpha induces matrix metalloproteinase-9 expression in A549 cells: role of TNFR1/TRAF2/PKCalpha-dependent signaling pathways.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20110607 2010 Differential activation of tumor necrosis factor receptors distinguishes between brains from Alzheimer's disease and non-demented patients.
20103630 2010 Multivalent DR5 peptides activate the TRAIL death pathway and exert tumoricidal activity.
20100586 2010 Tumor necrosis factor-alpha gene polymorphisms are associated with severity of acute graft-versus-host disease following matched unrelated donor bone marrow transplantation in children: a Pediatric Blood and Marrow Transplant Consortium study.
20098615 2010 Application of gene network analysis techniques identifies AXIN1/PDIA2 and endoglin haplotypes associated with bicuspid aortic valve.
20074469 Idiopathic recurrent pericarditis refractory to colchicine treatment can reveal tumor necrosis factor receptor-associated periodic syndrome.
20074459 TNFalpha and its receptors in psoriatic skin, before and after treatment with etanercept.
20066156 2010 Expression and function of TNF and IL-1 receptors on human regulatory T cells.
20062090 2010 Elevations of tumor necrosis factor receptor 1 at day 7 and acute graft-versus-host disease after allogeneic hematopoietic cell transplantation with nonmyeloablative conditioning.
20045350 2010 Generation of mouse macrophages expressing membrane-bound TNF variants with selectivity for TNFR1 or TNFR2.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19906316 2009 Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.
19892918 2009 Genetic risk factors for periodontitis in a Japanese population.
19890662 2010 TNF superfamily gene polymorphism as prognostic factor in early breast cancer.
19879354 2010 Dual function of cysteine rich domain (CRD) 1 of TNF receptor type 1: conformational stabilization of CRD2 and control of receptor responsiveness.
19879194 2009 Integration of genetic risk factors into a clinical algorithm for multiple sclerosis susceptibility: a weighted genetic risk score.
19865102 2010 Multiple sclerosis susceptibility alleles in African Americans.
19854717 2010 The chromosome 16q region associated with ankylosing spondylitis includes the candidate gene tumour necrosis factor receptor type 1-associated death domain (TRADD).
19845893 2009 Plasma concentrations of TNF-alpha and its soluble receptors sTNFR1 and sTNFR2 in patients with coronary artery disease.
19826638 2009 Silencing of tumor necrosis factor receptor 1 by siRNA in EC109 cells affects cell proliferation and apoptosis.
19825522 2009 Circulating levels of TNF-alpha and its soluble receptors in the plasma of patients with epithelial ovarian cancer.
19804406 2010 A novel Y331X nonsense mutation in TNFRSF1A gene in two unrelated Turkish families with periodic fever syndrome.
19801788 2009 Serum levels of TNF-alpha, TNF-alphaRI, TNF-alphaRII and IL-12 in treated rheumatoid arthritis patients.
19796978 2009 TNF receptor-associated periodic syndrome (TRAPS): a new cause of joint destruction?
19794511 2009 Multiple sclerosis. TNFRSF1A, TRAPS and multiple sclerosis.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19784808 2009 Doxorubicin-mediated apoptosis in glioma cells requires NFAT3.
19781631 2010 Proteinase-activated receptor-2 mediated inhibition of TNFalpha-stimulated JNK activation - A novel paradigm for G(q/11) linked GPCRs.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19772798 The role of tumor necrosis factor (TNF)-alpha and TNF receptor polymorphisms in susceptibility to ankylosing spondylitis.
19741298 2009 The tumor-promoting actions of TNF-alpha involve TNFR1 and IL-17 in ovarian cancer in mice and humans.
19738620 2009 Tumour necrosis factor gene polymorphism: a predictive factor for the development of post-transplant lymphoproliferative disease.
19701605 2010 sTNFR-1 is an early inflammatory marker in community versus institutionalized elderly women.
19692652 2009 MEK, p38, and PI-3K mediate cross talk between EGFR and TNFR in enhancing hepatocyte growth factor production from human mesenchymal stem cells.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690440 2009 Expression of tumor necrosis factor receptors on granulocytes in patients with myeloperoxidase anti-neutrophil cytoplasmic autoantibody-associated vasculitis.
19673872 2009 A novel missense mutation in tumour necrosis factor receptor superfamily 1A (TNFRSF1A) gene found in tumour necrosis factor receptor-associated periodic syndrome (TRAPS) manifesting adult-onset Still disease-like skin eruptions: report of a case and review of the Japanese patients.
19643942 2010 Systemic inflammatory markers in COPD: results from the Bergen COPD Cohort Study.
19641466 2010 Lack of association between tumour necrosis factor receptor types 1 and 2 gene polymorphism and severe acute alcoholic hepatitis.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19594495 2009 Somatic mutation of the death domain of TNF-R1 is rare in common cancers.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19582456 2010 The -383A>C TNFRI polymorphism is associated with soluble levels and clinical activity in rheumatoid arthritis.
19579027 2010 MEFV, TNF1rA, CARD15 and NLRP3 mutation analysis in PFAPA.
19556827 2009 Association of TNFA -308 G/A and TNFRI +36 A/G gene polymorphisms with glaucoma.
19541728 2009 Incidence of TNFRSF1A mutations in German children: epidemiological, clinical and genetic characteristics.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19525953 2009 Meta-analysis of genome scans and replication identify CD6, IRF8 and TNFRSF1A as new multiple sclerosis susceptibility loci.
19524513 2009 Phosphorylation-driven assembly of the RIP1-RIP3 complex regulates programmed necrosis and virus-induced inflammation.
19523687 2009 CCAAT/enhancer binding proteins alpha and beta regulate the tumor necrosis factor receptor 1 gene promoter.
19505916 2009 Cytokine and cytokine receptor single-nucleotide polymorphisms predict risk for non-small cell lung cancer among women.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19448410 2009 Inhibition of lung cancer cell proliferation by CD40 signaling through tumor necrosis factor I.
19390575 2009 Lung cancer susceptibility model based on age, family history and genetic variants.
19390513 2009 Soluble tumor necrosis factor receptor 1 level is associated with left ventricular hypertrophy: the northern Manhattan study.
19369902 Association between polymorphisms in tumor necrosis factor (TNF) and TNF receptor genes and circulating TNF, soluble TNF receptor levels, and bone mineral density in postmenopausal Korean women.
19339767 2009 Role of TNF-?, sTNF-R55 and sTNF-R75 in inflammation of acute exacerbations of chronic obstructive pulmonary disease.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19287455 2009 Tumor necrosis factor receptor-associated factor-1 enhances proinflammatory TNF receptor-2 signaling and modifies TNFR1-TNFR2 cooperation.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19246939 2009 Interferon beta-1a induces tumor necrosis factor receptor 1 but decreases tumor necrosis factor receptor 2 leukocyte mRNA levels in relapsing-remitting multiple sclerosis.
19242924 2009 First-trimester maternal serum matrix metalloproteinase-9 (MMP-9) and adverse pregnancy outcome.
19238748 2008 Tumor necrosis factor (TNF)-TNF receptor gene polymorphisms and their serum levels in Korean women with endometriosis.
19193342 2008 Multiple genetic factors in olanzapine-induced weight gain in schizophrenia patients: a cohort study.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19116900 2009 Novel markers of inflammation identified in tumor necrosis factor receptor-associated periodic syndrome (TRAPS) by transcriptomic analysis of effects of TRAPS-associated tumor necrosis factor receptor type I mutations in an endothelial cell line.
19084540 2009 Structure-function relationship of tumor necrosis factor (TNF) and its receptor interaction based on 3D structural analysis of a fully active TNFR1-selective TNF mutant.
19077906 2009 Apoptotic mechanisms in fulminant hepatic failure: potential therapeutic target.
19070941 2010 Soluble TNF receptors are associated with A? metabolism and conversion to dementia in subjects with mild cognitive impairment.
19029521 2008 Multiple sclerosis and the TNFRSF1A R92Q mutation: clinical characteristics of 21 cases.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18990758 2008 Genetic variation in tumor necrosis factor and the nuclear factor-kappaB canonical pathway and risk of non-Hodgkin's lymphoma.
18936101 2008 Alix and ALG-2 are involved in tumor necrosis factor receptor 1-induced cell death.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18807256 2008 Genetic regulation of amniotic fluid TNF-alpha and soluble TNF receptor concentrations affected by race and preterm birth.
18717726 2008 The role of IL-12 and TNF-alpha in AIDP and AMAN.
18715339 2008 Associations between cytokine/cytokine receptor single nucleotide polymorphisms and humoral immunity to measles, mumps and rubella in a Somali population.
18679053 2008 Increased serum levels of inflammatory markers in chronic institutionalized patients with schizophrenia.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18625701 2008 cAMP-dependent protein kinase A (PKA) signaling induces TNFR1 exosome-like vesicle release via anchoring of PKA regulatory subunit RIIbeta to BIG2.
18606683 2008 Type 1 TNF receptor forms a complex with and uses Jak2 and c-Src to selectively engage signaling pathways that regulate transcription factor activity.
18571427 2008 A potential role of TNFR gene polymorphisms in autoimmune thyroid diseases in the Tunisian population.
18544535 2008 Oxidative stress promotes ligand-independent and enhanced ligand-dependent tumor necrosis factor receptor signaling.
18541194 2008 Plasma elevations of tumor necrosis factor-receptor-1 at day 7 postallogeneic transplant correlate with graft-versus-host disease severity and overall survival in pediatric patients.
18538149 2008 Racial disparity in maternal-fetal genetic epistasis in spontaneous preterm birth.
18512793 2008 A diagnostic score for molecular analysis of hereditary autoinflammatory syndromes with periodic fever in children.
18510047 2008 [Expression of tumor necrosis factor-alpha (TNF-alpha) on peritoneal fluid mononuclear cells in women with endometriosis].
18508832 2008 CPAP decreases plasma levels of soluble tumour necrosis factor-alpha receptor 1 in obstructive sleep apnoea.
18445477 2008 An association between RBMX, a heterogeneous nuclear ribonucleoprotein, and ARTS-1 regulates extracellular TNFR1 release.
18415772 Soluble tumour necrosis factor receptors sTNFR1 and sTNFR2 are produced at sites of inflammation and are markers of arthritis activity in Behçet's disease.
18408954 2008 TNF receptor-associated periodic syndrome (TRAPS): description of a novel TNFRSF1A mutation and response to etanercept.
18338763 2008 Association of IL23R, TNFRSF1A, and HLA-DRB1*0103 allele variants with inflammatory bowel disease phenotypes in the Finnish population.
18337349 2008 Soluble tumor necrosis factor (TNF) receptors (sTNF-R1 and -R2) in pregnant women chronically infected with Trypanosoma cruzi and their children.
18333356 2007 Correlation between sTNFR-I and other negative prognostic factors in patients with chronic heart failure.
18287568 2008 TNFRSF1A R92Q mutation in association with a multiple sclerosis-like demyelinating syndrome.
18275007 2008 Amniotic fluid levels of tumor necrosis factor-alpha and soluble tumor necrosis factor receptor 1 before and after the onset of labor in normal pregnancies.
18248655 2008 Genetic polymorphisms of tumour necrosis factor receptor superfamily 1A and 1B affect responses to infliximab in Japanese patients with Crohn's disease.
18243134 2008 TNFR1 promoter -329G/T polymorphism results in allele-specific repression of TNFR1 expression.
18206417 2008 Association of TNF-alpha and TNFR1 promoters and 3' UTR region of TNFR2 gene polymorphisms with genetic susceptibility to tobacco-related oral carcinoma in Asian Indians.
18180277 2008 Clinical and functional characterisation of a novel TNFRSF1A c.605T>A/V173D cleavage site mutation associated with tumour necrosis factor receptor-associated periodic fever syndrome (TRAPS), cardiovascular complications and excellent response to etanercept treatment.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18167350 2008 Reduced display of tumor necrosis factor receptor I at the host cell surface supports infection with Chlamydia trachomatis.
18163488 2008 Abnormal tumor necrosis factor receptor I cell surface expression and NF-kappaB activation in tumor necrosis factor receptor-associated periodic syndrome.
18086728 2008 A novel TNFRSF1A splice mutation associated with increased nuclear factor kappaB (NF-kappaB) transcription factor activation in patients with tumour necrosis factor receptor associated periodic syndrome (TRAPS).
18083240 2008 TNF and sTNFR1/2 plasma levels in ALS patients.
18078813 2008 Circulating TNFR1 exosome-like vesicles partition with the LDL fraction of human plasma.
18068948 2008 Comparing Type D personality and older age as correlates of tumor necrosis factor-alpha dysregulation in chronic heart failure.
18067272 2008 Casein kinase 1alpha interacts with RIP1 and regulates NF-kappaB activation.
18058462 2007 Downregulation of survivin is associated with reductions in TNF receptors' mRNA and protein and alterations in nuclear factor kappa B signaling in urothelial cancer cells.
18022363 2007 IAP antagonists target cIAP1 to induce TNFalpha-dependent apoptosis.
17921876 2007 Dopamine induces TNFalpha and TNF-R1 expression in SH-SY5Y human neuroblastoma cells.
17852084 Soluble tumour necrosis factor-alpha receptor type 1 as a biomarker of response to phototherapy in patients with psoriasis.
17785864 2007 Interaction between transmembrane TNF and TNFR1/2 mediates the activation of monocytes by contact with T cells.
17763205 TNF receptor I polymorphism is associated with persistent palindromic rheumatism.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17693606 2007 The low-penetrance R92Q mutation of the tumour necrosis factor superfamily 1A gene is neither a major risk factor for Wegener's granulomatosis nor multiple sclerosis.
17688691 2007 Catabolic cytokine expression in degenerate and herniated human intervertebral discs: IL-1beta and TNFalpha expression profile.
17686637 2007 Tumour necrosis factor-alpha receptor 1 polymorphisms and serum soluble TNFR1 in early spontaneous miscarriage.
17665448 2007 Late-onset tumor necrosis factor receptor-associated periodic syndrome in multiple sclerosis patients carrying the TNFRSF1A R92Q mutation.
17665435 2007 Mutant tumor necrosis factor receptor associated with tumor necrosis factor receptor-associated periodic syndrome is altered antigenically and is retained within patients' leukocytes.
17564788 2007 Tumor necrosis factor receptor-associated periodic syndrome with a C30R mutation in a Japanese family.
17530646 2007 TNF polymorphisms in psoriasis: association of psoriatic arthritis with the promoter polymorphism TNF*-857 independent of the PSORS1 risk allele.
17477815 2007 Polymorphisms in proinflammatory genes and susceptibility to typhoid fever and paratyphoid fever.
17431682 2007 Linkage and association analysis of candidate genes for TB and TNFalpha cytokine expression: evidence for association with IFNGR1, IL-10, and TNF receptor 1 genes.
17346438 Inflammation and atherosclerosis: the role of TNF and TNF receptors polymorphisms in coronary artery disease.
17324927 2007 Identification of a dominant negative functional domain on DAPK-1 that degrades DAPK-1 protein and stimulates TNFR-1-mediated apoptosis.
17267158 2007 Protein and gene expression of tumour necrosis factor receptors I and II and their promoter gene polymorphisms in Alzheimer's disease.
17234651 2007 The TNFRSF1A R92Q mutation is frequent in rheumatoid arthritis but shows no evidence for association or linkage with the disease.
17200772 2007 Polymorphism A36G of the tumor necrosis factor receptor 1 gene is associated with PAI-1 levels in obese women.
17105909 2006 Association study of the tumor necrosis factor-alpha gene and its 1A receptor gene with methamphetamine dependence.
17075277 2006 Tumor necrosis factor receptor-associated periodic syndrome mimicking systemic juvenile idiopathic arthritis.
17051333 2006 EMAP-II facilitates TNF-R1 apoptotic signalling in endothelial cells and induces TRADD mobilization.
17010968 2006 The shedding activity of ADAM17 is sequestered in lipid rafts.
16859822 2007 Expression and localization of tumor necrosis factor receptor 1 protein in the chorionic villi in early normal and spontaneous abortion.
16732051 2006 Divergent relationships among soluble tumor necrosis factor-alpha receptors 1 and 2, insulin resistance, and endothelial function.
16731080 2006 Multilocus interactions at maternal tumor necrosis factor-alpha, tumor necrosis factor receptors, interleukin-6 and interleukin-6 receptor genes predict spontaneous preterm labor in European-American women.
16611992 2006 Competitive control of independent programs of tumor necrosis factor receptor-induced cell death by TRADD and RIP1.
16580225 2006 Expression of tumor necrosis factor alpha and its receptors during cellular differentiation.
16541075 2006 The finished DNA sequence of human chromosome 12.
16533817 2006 Aminopeptidase N (CD13) regulates tumor necrosis factor-alpha-induced apoptosis in human neutrophils.
16463024 2006 The TNFalpha receptor TNFRSF1A and genes encoding the amiloride-sensitive sodium channel ENaC as modulators in cystic fibrosis.
16447098 2006 TNF-receptor-associated periodic syndrome (TRAPS): an autosomal dominant multisystem disorder.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
16282562 2005 Physical function and its response to exercise: associations with cytokine gene variation in older adults with knee osteoarthritis.
16277675 2005 Polymorphism in the tumour necrosis factor receptor II gene is associated with circulating levels of soluble tumour necrosis factor receptors in rheumatoid arthritis.
16260783 2005 TAK1 is recruited to the tumor necrosis factor-alpha (TNF-alpha) receptor 1 complex in a receptor-interacting protein (RIP)-dependent manner and cooperates with MEKK3 leading to NF-kappaB activation.
16234278 2006 Approach to genetic analysis in the diagnosis of hereditary autoinflammatory syndromes.
16227624 2005 PAK4 functions in tumor necrosis factor (TNF) alpha-induced survival pathways by facilitating TRADD binding to the TNF receptor.
16216134 2005 The tumour necrosis factor receptor-associated periodic syndrome: current concepts.
16195372 2005 TNFR1- and TNFR2-mediated signaling pathways in human kidney are cell type-specific and differentially contribute to renal injury.
16153798 2005 Genomic approach of AIDS pathogenesis: exhaustive genotyping of the TNFR1 gene in a French AIDS cohort.
16142859 2005 Anemia in rheumatoid arthritis: association with polymorphism in the tumor necrosis factor receptor I and II genes.
16134057 2005 Expression of TNFalpha and its receptors R1 and R2 in human alveolar epithelial cells exposed to organic dust and the effects of 8-bromo-cAMP and protein kinase A modulation.
16043808 2005 Mechanical hyperalgesia in complex regional pain syndrome: a role for TNF-alpha?
16043718 2005 Disabling TNF receptor signaling by induced conformational perturbation of tryptophan-107.
15949439 2005 The tumor suppressor RASSF1A and MAP-1 link death receptor signaling to Bax conformational change and cell death.
15943902 2005 Distinct differences between TNF receptor 1- and TNF receptor 2-mediated activation of NFkappaB.
15851552 2005 TNF-857T, a genetic risk marker for acute anterior uveitis.
15842589 2005 Tumor necrosis factor receptor gene polymorphisms in Crohn's disease: association with clinical phenotypes.
15818692 2005 Reduced tumor necrosis factor signaling in primary human fibroblasts containing a tumor necrosis factor receptor superfamily 1A mutant.
15817701 2005 TNFR1-induced sphingomyelinase activation modulates TCR signaling by impairing store-operated Ca2+ influx.
15787661 2005 Tumour necrosis factor receptors (TNFRs) in Type 2 diabetes. Analysis of soluble plasma fractions and genetic variations of TNFR2 gene in a case-control study.
15692984 2005 Association of the R92Q TNFRSF1A mutation and extracranial deep vein thrombosis in patients with Behçet's disease.
15586174 2005 Unexpected high frequency of P46L TNFRSF1A allele in sub-Saharan West African populations.
15542843 2004 Sustained activation of p38 mitogen-activated protein kinase and c-Jun N-terminal kinase pathways by hepatitis B virus X protein mediates apoptosis via induction of Fas/FasL and tumor necrosis factor (TNF) receptor 1/TNF-alpha expression.
15526005 2004 TNF and TNFR polymorphisms in severe sepsis and septic shock: a prospective multicentre study.
15502938 2004 Involvement of tumor necrosis factor-alpha receptor 1 and tumor necrosis factor-related apoptosis-inducing ligand-(TRAIL) receptor-2/DR-5, but not Fas, in graft injury in live-donor liver transplantation.
15492850 2004 Novel mutations in TNFRSF1A in patients with typical tumor necrosis factor receptor-associated periodic syndrome and with systemic lupus erythematosus in Japanese.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485837 2004 NAK is recruited to the TNFR1 complex in a TNFalpha-dependent manner and mediates the production of RANTES: identification of endogenous TNFR-interacting proteins by a proteomic approach.
15465831 2004 A death receptor-associated anti-apoptotic protein, BRE, inhibits mitochondrial apoptotic pathway.
15457442 2004 The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept.
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
15289829 2004 Demethylating agent 5-aza-2'-deoxycytidine enhances expression of TNFRI and promotes TNF-mediated apoptosis in vitro and in vivo.
15288471 2004 Soluble TNF-R1, but not tumor necrosis factor alpha, predicts the 3-month mortality in patients with alcoholic hepatitis.
15274667 2004 Tumour necrosis factor-alpha receptor 1 and 2 polymorphisms in inflammatory bowel disease and their association with response to infliximab.
15251454 2004 Analysis of human tumour necrosis factor receptor 1 dominant-negative mutants reveals a major region controlling cell surface expression.
15188372 2004 Molecular analysis of the MVK and TNFRSF1A genes in patients with a clinical presentation typical of the hyperimmunoglobulinemia D with periodic fever syndrome: a low-penetrance TNFRSF1A variant in a heterozygous MVK carrier possibly influences the phenotype of hyperimmunoglobulinemia D with periodic fever syndrome or vice versa.
15146559 2004 Promoter polymorphisms of tumor necrosis factor-alpha are associated with risk of gastric mucosa-associated lymphoid tissue lymphoma.
15071491 2004 Allelic variants in genes associated with hereditary periodic fever syndromes as susceptibility factors for reactive systemic AA amyloidosis.
15063762 2004 Genetic variations in humans associated with differences in the course of hepatitis C.
15041705 2004 Transendothelial migration of myeloma cells is increased by tumor necrosis factor (TNF)-alpha via TNF receptor 2 and autocrine up-regulation of MCP-1.
15018649 2004 Complex genetic predisposition in adult and juvenile rheumatoid arthritis.
14872483 2004 A TNFR1 genotype with a protective role in familial rheumatoid arthritis.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14728878 2003 [A study on early activation of T lymphocytes and soluble tumor necrosis factor receptor in patients with myelodysplastic syndrome].
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14694358 2004 Polymorphism R92Q of the tumour necrosis factor receptor 1 gene is associated with myocardial infarction and carotid intima-media thickness--the ECTIM, AXA, EVA and GENIC Studies.
14671137 2004 Epstein-Barr virus immediate-early protein BZLF1 inhibits tumor necrosis factor alpha-induced signaling and apoptosis by downregulating tumor necrosis factor receptor 1.
14610673 2004 Tumour necrosis factor receptor-associated periodic syndrome with a novel mutation in the TNFRSF1A gene in a Japanese family.
14585990 2003 TRUSS, a novel tumor necrosis factor receptor 1 scaffolding protein that mediates activation of the transcription factor NF-kappaB.
13130484 2003 Heterogeneity among patients with tumor necrosis factor receptor-associated periodic syndrome phenotypes.
12913922 2003 Preferential induction of prodestructive matrix metalloproteinase-1 and proinflammatory interleukin 6 and prostaglandin E2 in rheumatoid arthritis synovial fibroblasts via tumor necrosis factor receptor-55.
12911633 2003 Expression of death-associated protein kinase and recruitment to the tumor necrosis factor signaling pathway following brief seizures.
12887920 2003 Induction of TNF receptor I-mediated apoptosis via two sequential signaling complexes.
12887914 2003 The TNF receptor 1: a split personality complex.
12879482 2003 Levels of the soluble, 55-kilodalton isoform of tumor necrosis factor receptor in bone marrow are correlated with the clinical outcome of children with acute lymphoblastic leukemia in first recurrence.
12858434 2003 No association of polymorphisms in the tumor necrosis factor receptor I and receptor II genes with disease severity in rheumatoid arthritis.
12832748 TNFRSF1A-associated periodic syndrome (TRAPS), Muckle-Wells syndrome (MWS) and renal amyloidosis.
12818408 2003 A polymorphism in the promoter of the tumor necrosis factor-alpha gene (-308) is associated with coronary heart disease in type 2 diabetic patients.
12811828 2003 Modulation of PAI-1 and proMMP-9 syntheses by soluble TNFalpha and its receptors during differentiation of the human monocytic HL-60 cell line.
12786601 2003 Distinct regulation of cytosolic phospholipase A2 phosphorylation, translocation, proteolysis and activation by tumour necrosis factor-receptor subtypes.
12768019 2003 Human cytomegalovirus infection inhibits tumor necrosis factor alpha (TNF-alpha) signaling by targeting the 55-kilodalton TNF-alpha receptor.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12748171 2003 An aminopeptidase, ARTS-1, is required for interleukin-6 receptor shedding.
12748169 2003 Tumor necrosis factor-induced nuclear factor kappaB activation is impaired in focal adhesion kinase-deficient fibroblasts.
12730509 2003 Association of polymorphisms of the tumour necrosis factor receptors I and II and rheumatoid arthritis.
12706861 2003 Overexpression of the 'silencer of death domain', SODD/BAG-4, modulates both TNFR1- and CD95-dependent cell death pathways.
12690082 2003 Plasma leptin, fatty acids, and tumor necrosis factor-receptor and insulin resistance in children.
12661999 2003 Tumour necrosis factor family genes in a phenotype of COPD associated with emphysema.
12651071 2003 Influence of cytokine and mannose binding protein gene polymorphisms on human T-cell leukemia virus type I (hTLV-I) provirus load in HTLV-I asymptomatic carriers.
12644782 Hereditary, familial, and idiopathic chronic pancreatitis are not associated with polymorphisms in the tumor necrosis factor alpha (TNF-alpha) promoter region or the TNF receptor 1 (TNFR1) gene.
12610052 2003 Soluble tumor necrosis factor-alpha receptors in young obese subjects with normal and impaired glucose tolerance.
12601524 2003 Polymorphisms of the tumor necrosis factor receptors: no association with narcolepsy in German patients.
12559634 2003 TNF, TNF receptor type 1, and allograft inflammatory factor-1 gene polymorphisms in Japanese patients with type 1 diabetes.
12530121 2002 Elevation of serum eosinophil cationic protein, soluble tumor necrosis factor receptors and soluble intercellular adhesion molecule-1 levels in acute bronchial asthma.
12500222 2003 Elevated serum levels of the type I and type II receptors for tumor necrosis factor-alpha as predictive factors for ARF in patients with septic shock.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391233 2002 Interaction with factor associated with neutral sphingomyelinase activation, a WD motif-containing protein, identifies receptor for activated C-kinase 1 as a novel component of the signaling pathways of the p55 TNF receptor.
12376300 2002 Detection of soluble tumor necrosis factor-p55 levels in the serum and ascitic fluid of patients with hepatocellular carcinoma.
12353079 2002 Relationships between fibrinolytic and inflammatory parameters in human adipose tissue: strong contribution of TNFalpha receptors to PAI-1 levels.
12220546 Role of TNF/TNFR in autoimmunity: specific TNF receptor blockade may be advantageous to anti-TNF treatments.
12209523 2002 The enlarging clinical, genetic, and population spectrum of tumor necrosis factor receptor-associated periodic syndrome.
12209507 2002 Single-nucleotide polymorphisms in tumor necrosis factor receptor genes: definition of novel haplotypes and racial/ethnic differences.
12189246 2002 Identification of ARTS-1 as a novel TNFR1-binding protein that promotes TNFR1 ectodomain shedding.
12147741 2002 Gene expression profiling of ameloblastoma and human tooth germ by means of a cDNA microarray.
12115625 2002 TNFalpha-induced macrophage chemokine secretion is more dependent on NF-kappaB expression than lipopolysaccharides-induced macrophage chemokine secretion.
12107724 2002 Impaired glucose tolerance is associated with increased serum concentrations of interleukin 6 and co-regulated acute-phase proteins but not TNF-alpha or its receptors.
12105243 2002 Mutational spectrum in the MEFV and TNFRSF1A genes in patients suffering from AA amyloidosis and recurrent inflammatory attacks.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12049175 2002 Pharmacogenetic investigation of the TNF/TNF-receptor system in patients with chronic active Crohn's disease treated with infliximab.
12040173 2002 TNF-R1 signaling: a beautiful pathway.
12017295 Altered signaling of TNFalpha-TNFR1 and SODD/BAG4 is responsible for radioresistance in human HT-R15 cells.
11985495 2002 The p55 tumour necrosis factor receptor TNFR1 contains a trans-Golgi network localization signal in the C-terminal region of its cytoplasmic tail.
11961180 2002 Tumour necrosis factor receptor II polymorphism and juvenile idiopathic arthritis.
11934887 2002 The human papillomavirus 16 E6 protein binds to tumor necrosis factor (TNF) R1 and protects cells from TNF-induced apoptosis.
11909948 2002 Tumor necrosis factor receptor 1 is an ATPase regulated by silencer of death domain.
11904678 2002 Polymorphisms of the TNF gene and the TNF receptor superfamily member 1B gene are associated with susceptibility to ulcerative colitis and Crohn's disease, respectively.
11882518 2002 Shedding of TNF-alpha receptors, blood pressure, and insulin sensitivity in type 2 diabetes mellitus.
11861282 2002 Increased sensitivity of T lymphocytes to tumor necrosis factor receptor 1 (TNFR1)- and TNFR2-mediated apoptosis in HIV infection: relation to expression of Bcl-2 and active caspase-8 and caspase-3.
11801527 2002 Tumor necrosis factor alpha (TNF-alpha) activates Jak1/Stat3-Stat5B signaling through TNFR-1 in human B cells.
11786908 2002 Death receptors bind SHP-1 and block cytokine-induced anti-apoptotic signaling in neutrophils.
11755217 2001 Caspase 7 can cleave tumor necrosis factor receptor-I (p60) at a non-consensus motif, in vitro.
11737221 2001 Polymorphisms in the TNF-alpha and TNF-receptor genes in patients with coronary artery disease.
11684708 2001 Keratin attenuates tumor necrosis factor-induced cytotoxicity through association with TRADD.
11606045 2001 Heterogeneity in the phosphorylation of human death receptors by p42(mapk/erk2).
11598334 2001 Lack of evidence for an association between two genetic polymorphisms in the tumor necrosis factor receptor 1 gene and multiple sclerosis in Ashkenazi Jews.
11562425 2001 Tumor necrosis factor receptor (TNFR) 1, but not TNFR2, mediates tumor necrosis factor-alpha-induced interleukin-6 and RANTES in human airway smooth muscle cells: role of p38 and p42/44 mitogen-activated protein kinases.
11528523 2001 Different allelic frequencies of several cytokine genes in Hong Kong Chinese and Swedish Caucasians.
11522182 2001 HIV type 1 Tat inhibits tumor necrosis factor alpha-induced repression of tumor necrosis factor receptor p55 and amplifies tumor necrosis factor alpha activity in stably tat-transfected HeLa Cells.
11443543 2001 The tumor-necrosis-factor receptor-associated periodic syndrome: new mutations in TNFRSF1A, ancestral origins, genotype-phenotype studies, and evidence for further genetic heterogeneity of periodic fevers.
11212177 2001 Association between rheumatoid arthritis and polymorphism of tumor necrosis factor receptor II, but not tumor necrosis factor receptor I, in Caucasians.
11196686 2000 Tumor necrosis factor gene polymorphisms in patients with cirrhosis from chronic hepatitis C virus infection.
11175303 2001 Tumor necrosis factor receptor-associated periodic syndrome (TRAPS) in a Dutch family: evidence for a TNFRSF1A mutation with reduced penetrance.
11163081 2000 Tumor necrosis factor, tumor necrosis factor receptors type 1 and 2, lymphotoxin-alpha, and HLA-DRB1 gene polymorphisms in human T-cell lymphotropic virus type I associated myelopathy.
11098060 2001 TRAF1 is a substrate of caspases activated during tumor necrosis factor receptor-alpha-induced apoptosis.
11072751 2000 Genetic analysis of immunomodulating factors in sporadic Parkinson's disease.
10911999 2000 Solution structure of N-TRADD and characterization of the interaction of N-TRADD and C-TRAF2, a key step in the TNFR1 signaling pathway.
10902757 2000 A novel missense mutation (C30S) in the gene encoding tumor necrosis factor receptor 1 linked to autosomal-dominant recurrent fever with localized myositis in a French family.
10875917 2000 A domain in TNF receptors that mediates ligand-independent receptor assembly and signaling.
10848577 2000 Stat1 as a component of tumor necrosis factor alpha receptor 1-TRADD signaling complex to inhibit NF-kappaB activation.
10755617 2000 Recruitment of the IKK signalosome to the p55 TNF receptor: RIP and A20 bind to NEMO (IKKgamma) upon receptor stimulation.
10706119 2000 APRIL/TRDL-1, a tumor necrosis factor-like ligand, stimulates cell death.
10634209 1999 TNF-induced signaling in apoptosis.
10542291 1999 F1Aalpha, a death receptor-binding protein homologous to the Caenorhabditis elegans sex-determining protein, FEM-1, is a caspase substrate that mediates apoptosis.
10359574 1999 Identification of Grb2 as a novel binding partner of tumor necrosis factor (TNF) receptor I.
10356400 1999 The interaction of p62 with RIP links the atypical PKCs to NF-kappaB activation.
10339433 1999 Identification of RIP3, a RIP-like kinase that activates apoptosis and NFkappaB.
10199409 1999 Germline mutations in the extracellular domains of the 55 kDa TNF receptor, TNFR1, define a family of dominantly inherited autoinflammatory syndromes.
10187798 1999 The ubiquitin-homology protein, DAP-1, associates with tumor necrosis factor receptor (p60) death domain and induces apoptosis.
9915703 1999 Prevention of constitutive TNF receptor 1 signaling by silencer of death domains.
9753329 1998 Structure of type IIbeta phosphatidylinositol phosphate kinase: a protein kinase fold flattened for interfacial phosphorylation.
9642260 1998 RIP2 is a novel NF-kappaB-activating and cell death-inducing kinase.
9585614 1998 Linkage of familial Hibernian fever to chromosome 12p13.
9563508 1998 hUBC9 associates with MEKK1 and type I TNF-alpha receptor and stimulates NFkappaB activity.
9557650 1998 Hepatitis C virus core protein binds to the cytoplasmic domain of tumor necrosis factor (TNF) receptor 1 and enhances TNF-induced apoptosis.
9510175 1998 Induction of Jak/STAT signaling by activation of the type 1 TNF receptor.
9126987 1997 Two-hybrid cloning of a gene encoding TNF receptor-associated protein 2, a protein that interacts with the intracellular domain of the type 1 TNF receptor: identity with subunit 2 of the 26S protease.
9115275 1997 MADD, a novel death domain protein that interacts with the type 1 tumor necrosis factor receptor and activates mitogen-activated protein kinase.
9045686 1997 Fas-associated death domain protein interleukin-1beta-converting enzyme 2 (FLICE2), an ICE/Ced-3 homologue, is proximally involved in CD95- and p55-mediated death signaling.
9038203 1997 A novel interaction between the juxtamembrane region of the p55 tumor necrosis factor receptor and phosphatidylinositol-4-phosphate 5-kinase.
8943045 1996 The tumor necrosis factor receptor 2 signal transducers TRAF2 and c-IAP1 are components of the tumor necrosis factor receptor 1 signaling complex.
8939750 1996 Structures of the extracellular domain of the type I tumor necrosis factor receptor.
8934525 1996 A death-domain-containing receptor that mediates apoptosis.
8906799 1996 Protection against Fas/APO-1- and tumor necrosis factor-mediated cell death by a novel protein, sentrin.
8808629 1996 FAN, a novel WD-repeat protein, couples the p55 TNF-receptor to neutral sphingomyelinase.
8621670 1996 Systematic mutational analysis of the death domain of the tumor necrosis factor receptor 1-associated protein TRADD.
8612133 1996 TNF-dependent recruitment of the protein kinase RIP to the TNF receptor-1 signaling complex.
8565075 1996 TRADD-TRAF2 and TRADD-FADD interactions define two distinct TNF receptor 1 signal transduction pathways.
8387891 1993 Crystal structure of the soluble human 55 kd TNF receptor-human TNF beta complex: implications for TNF receptor activation.
8077196 1994 Aggregation of the intracellular domain of the type 1 tumor necrosis factor receptor defined by the two-hybrid system.
8015639 1994 Purification of two types of TNF inhibitors in the urine of the patient with chronic glomerulonephritis.
7995952 1995 Characterization of surface lymphotoxin forms. Use of specific monoclonal antibodies and soluble receptors.
7901149 1993 Expression of membrane receptor for tumour necrosis factor on human blood lymphocytes.
7876093 1995 Identification of a protein with homology to hsp90 that binds the type 1 tumor necrosis factor receptor.
7758105 1995 The TNF receptor 1-associated protein TRADD signals cell death and NF-kappa B activation.
7664431 1995 Expression and functional significance of tumor necrosis factor receptors in human myocardium.
7601280 1995 A protein related to a proteasomal subunit binds to the intracellular domain of the p55 TNF receptor upstream to its 'death domain'.
7156325 1982 Familial Hibernian fever.
3001529 1985 Characterization of receptors for human tumour necrosis factor and their regulation by gamma-interferon.
2848815 1988 Human tumor necrosis factor-alpha receptor. Purification by immunoaffinity chromatography and initial characterization.
2170974 1990 Cloning of human tumor necrosis factor (TNF) receptor cDNA and expression of recombinant soluble TNF-binding protein.
2158863 1990 Molecular cloning and expression of a receptor for human tumor necrosis factor.
2158862 1990 Molecular cloning and expression of the human 55 kd tumor necrosis factor receptor.
2153136 1990 Two tumor necrosis factor-binding proteins purified from human urine. Evidence for immunological cross-reactivity with cell surface tumor necrosis factor receptors.
1702293 1990 Molecular cloning and expression of human and rat tumor necrosis factor receptor chain (p60) and its soluble derivative, tumor necrosis factor-binding protein.
1698610 1990 Soluble forms of tumor necrosis factor receptors (TNF-Rs). The cDNA for the type I TNF-R, cloned using amino acid sequence data of its soluble form, encodes both the cell surface and a soluble form of the receptor.
1655358 1991 Chromosomal location of the human tumor necrosis factor receptor genes.
1648547 1991 The gene for the type 1 tumor necrosis factor receptor (TNF-R1) is localized on band 12p13.
1331108 1992 Site-directed mutational analysis of human tumor necrosis factor-alpha receptor binding site and structure-functional relationship.
1315717 1992 Structure of the human TNF receptor 1 (p60) gene (TNFR1) and localization to chromosome 12p13 [corrected].
1087798 1976 [Effect of antibodies to rat and human cerebral cortex and white matter on heterologous T- and B-cells].