Property Summary

NCBI Gene PubMed Count 53
PubMed Score 233.67
PubTator Score 93.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma 1.100 1.0e-02
non-small cell lung cancer 1.421 1.1e-11
tuberculosis -1.400 2.5e-04

Protein-protein Interaction (1)

Gene RIF (39)

AA Sequence

MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEW      1 - 70
DCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFL     71 - 140
TVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLLTSAQLGLHIWQLRSQCMWPRETQLLLEVPP    141 - 210
STEDARSCQFPEEERGERSAEEKGRLGDLWV                                           211 - 241
//

Text Mined References (55)

PMID Year Title