Property Summary

NCBI Gene PubMed Count 48
PubMed Score 215.59
PubTator Score 93.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
tuberculosis -1.400 2.5e-04
non-small cell lung cancer 1.421 1.1e-11
invasive ductal carcinoma 1.100 1.0e-02

Gene RIF (36)

PMID Text
25973846 GITR expression can enhance the sensitivity to Bortezomib by inhibiting Bortezomib-induced NF-kappaB activation.
25961057 GITR is a crucial player in differentiation of thymic regulatory T cells and expansion of regulatory T cells, including both thymic regulatory T cells and peripheral regulatory T cells.
25445616 results suggest that the GITR rs3753348 polymorphism may be involved in the development and susceptibility of CWP.
25256257 Data may suggest a key role of regulatory GITR+CD25 low/-CD4+ T cells subset in the modulation of the abnormal immune response in lupus erythematosus (SLE) patients.
23935647 Our findings indicate the possible involvement of GITR-GITRL pathway in the pathogenesis of pSS.
23929911 these results show a higher susceptibility to apoptosis in patients' versus controls' T(reg) cells, suggesting that GITR is a T(reg)-cell marker that would be primarily involved in T(reg)-cell survival rather than in their suppressor function.
23785514 GITR acts as a potential tumor suppressor in MM.
23432692 Data indicate that the mRNAs of CTLA-4 and GITR genes were expressed at lower levels in CVID patients compared to control group.
22911397 Liver tumor Tregs up-regulate the expression of glucocorticoid-induced tumor necrosis factor receptor compared with Tregs in tumor-free liver tissue and blood.
22516990 GITR is pathologically expressed on Treg cells in systemic lupus erythematosus.
22309286 Results suggest that GITR expression might indicate a molecular link between steroid use and complicated acute sigmoid diverticulitis. Increased MMP-9 expression by GITR signalling might explain morphological changes in the colonic wall in diverticulitis.
22064350 GITRL may contribute to disease pathophysiology and resistance to direct and Rituximab-induced NK reactivity in CLL
22028176 DCs transfected with mRNA encoding a humanized anti-CTLA-4 mAb and mRNA encoding a soluble human GITR fusion protein enhance the induction of anti-tumor CTLs in response to DCs.
21705620 Although GITR transgene costimulation can therapeutically enhance T helper (Th) type 2 cell responses, GITR-GITR ligand interactions are not required for development of Th2-mediated resistance or pathology.
21694467 Findings suggest that GITR-expression of TILs is associated with cancer progression.
21670968 GITR, which transmits a signal that abrogates regulatory T cell functions, was elevated in early rheumatoid arthritis.
21592113 study concludes, the rs3753348 C/G SNP in the GITR is associated with Hashimoto's disease prognosis and expression on T(reg) and T(eff) cells
21557210 Data indicate that CD4(+) CD25(low) GITR(+) cells represent a low percentage of the CD4(+) T-cell population (0.32-1.74%) and are mostly memory cells.
21445534 The regulatory SNPs identified in this study will provide useful information for understanding the relevance of sequence polymorphisms in populations of different background and may serve as a basis to study parasite susceptibility in association studies
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19547759 mRNA level for CTLA-4, ICOS1, IL-23, IL-27, SMAD3 and GITR were lower in T regulatory cells of children with diabetes compared to the control patients
19423540 Observational study of gene-disease association. (HuGE Navigator)
19155305 Data show that in humans GITRL expression subverts NK cell immunosurveillance of AML.
18987746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18924213 mechanism of IgG4 induction by regulatory cells involves GITR-GITR-L interactions, IL-10 and TGF-beta.
18723571 CD4(+)CD25(+) effector memory T-cells expressing CD134 and GITR seem to play a role in disease mechanisms, as suggested by their close association with disease activity and their participation in the inflammatory process in Wegener's granulomatosis.
18230609 although GITR is an activation marker for NK cells similar to that for T cells, GITR serves as a negative regulator for NK cell activation
17538882 These data suggest that, despite abnormal GITR expression during HIV infection, GITR triggering enhances HIV-specific CD4(+) T cell cytokine expression and protects HIV-specific CD4(+) T cells from apoptosis.
17360848 This protein has been shown to stimulate T cell-mediated antitumor immunity in mice, and now in a human tumor cell line.
16955181 Since regulatory T-cells are localized in the vicinity of GITRL-expressing cells in atopic dermatitis skin, the GITR/GITRL interaction may serve to perpetuate the inflammation locally.
15944293 GITR rapidly recruits TNF receptor-associated factor 2 (TRAF2) in a ligand-dependent manner; data indicate that the cytoplasmic domain of GITR contains a single TRAF binding site where acidic residues 202/203 and 211-213 are critical for this interaction.
15301860 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEW      1 - 70
DCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFL     71 - 140
TVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLLTSAQLGLHIWQLRSQCMWPRETQLLLEVPP    141 - 210
STEDARSCQFPEEERGERSAEEKGRLGDLWV                                           211 - 241
//

Text Mined References (50)

PMID Year Title
25973846 2015 Expression of GITR Enhances Multiple Myeloma Cell Sensitivity to Bortezomib.
25961057 2015 Glucocorticoid-induced tumour necrosis factor receptor-related protein: a key marker of functional regulatory T cells.
25445616 2014 GITR promoter polymorphism contributes to risk of coal workers' pneumoconiosis: a case-control study from China.
25256257 2014 Expansion of regulatory GITR+CD25 low/-CD4+ T cells in systemic lupus erythematosus patients.
23935647 2013 Correlation of increased blood levels of GITR and GITRL with disease severity in patients with primary Sjögren's syndrome.
23929911 2013 Low frequency of GITR+ T cells in ex vivo and in vitro expanded Treg cells from type 1 diabetic patients.
23892569 2013 Glucocorticoid-induced tumor necrosis factor receptor family-related ligand triggering upregulates vascular cell adhesion molecule-1 and intercellular adhesion molecule-1 and promotes leukocyte adhesion.
23785514 2013 Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma.
23432692 2013 Frequency and expression of inhibitory markers of CD4(+) CD25(+) FOXP3(+) regulatory T cells in patients with common variable immunodeficiency.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22911397 2013 Activated tumor-infiltrating CD4+ regulatory T cells restrain antitumor immunity in patients with primary or metastatic liver cancer.
22516990 2012 [Effects of glucocorticoids on the expression of GTIR and apoptosis of the CD4(+)CD25(+)CD127(dim/-) T cells in patients with systemic lupus erythematosus].
22309286 2012 Glucocorticoid-induced tumour necrosis factor receptor expression: a potential molecular link between steroid intake and complicated diverticulitis?
22064350 2012 Glucocorticoid-induced TNFR-related protein (GITR) ligand modulates cytokine release and NK cell reactivity in chronic lymphocytic leukemia (CLL).
22028176 2011 Enhancement of anti-tumor immunity through local modulation of CTLA-4 and GITR by dendritic cells.
21705620 2011 Th2 responses to helminth parasites can be therapeutically enhanced by, but are not dependent upon, GITR-GITR ligand costimulation in vivo.
21694467 2010 Glucocorticoid-induced TNFR family-related receptor (GITR)-expression in tumor infiltrating leucocytes (TILs) is associated with the pathogenesis of esophageal adenocarcinomas with and without Barrett's mucosa.
21670968 2012 Abrogation of Treg function deteriorates rheumatoid arthritis.
21592113 2011 Association of functional GITR gene polymorphisms related to expression of glucocorticoid-induced tumour necrosis factor-receptor (GITR) molecules with prognosis of autoimmune thyroid disease.
21557210 2011 CD4(+) CD25(low) GITR(+) cells: a novel human CD4(+) T-cell population with regulatory activity.
21445534 2011 Novel regulatory SNPs in the promoter region of the TNFRSF18 gene in a Gabonese population.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19547759 2009 Diminished expression of ICOS, GITR and CTLA-4 at the mRNA level in T regulatory cells of children with newly diagnosed type 1 diabetes.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19155305 2009 Glucocorticoid-induced tumor necrosis factor receptor-related protein ligand subverts immunosurveillance of acute myeloid leukemia in humans.
18987746 2008 Association of interacting genes in the toll-like receptor signaling pathway and the antibody response to pertussis vaccination.
18924213 2008 Tr1 and naturally occurring regulatory T cells induce IgG4 in B cells through GITR/GITR-L interaction, IL-10 and TGF-beta.
18723571 2009 CD4+CD25+ T-cell populations expressing CD134 and GITR are associated with disease activity in patients with Wegener's granulomatosis.
18230609 2008 Glucocorticoid-induced tumor necrosis factor receptor negatively regulates activation of human primary natural killer (NK) cells by blocking proliferative signals and increasing NK cell apoptosis.
17538882 2007 Glucocorticoid-induced tumor necrosis factor receptor family-related protein triggering enhances HIV-specific CD4+ T cell cytokine secretion and protects HIV-specific CD4+ T cells from apoptosis.
17360848 2007 Cancer immunoediting by GITR (glucocorticoid-induced TNF-related protein) ligand in humans: NK cell/tumor cell interactions.
16955181 2006 Glucocorticoid-induced tumour necrosis factor receptor (GITR) and its ligand (GITRL) in atopic dermatitis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15944293 2005 Glucocorticoid-induced TNF receptor, a costimulatory receptor on naive and activated T cells, uses TNF receptor-associated factor 2 in a novel fashion as an inhibitor of NF-kappa B activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070049 2002 Role of GITR in activation response of T lymphocytes.
11869690 2002 CD4(+)CD25(+) immunoregulatory T cells: gene expression analysis reveals a functional role for the glucocorticoid-induced TNF receptor.
11812990 2002 Stimulation of CD25(+)CD4(+) regulatory T cells through GITR breaks immunological self-tolerance.
10836847 2000 Identification of three novel mRNA splice variants of GITR.
10074428 1999 Identification of a new member of the tumor necrosis factor family and its receptor, a human ortholog of mouse GITR.
10037686 1999 Identification of a novel activation-inducible protein of the tumor necrosis factor receptor superfamily and its ligand.
9177197 1997 A new member of the tumor necrosis factor/nerve growth factor receptor family inhibits T cell receptor-induced apoptosis.