Property Summary

NCBI Gene PubMed Count 54
PubMed Score 38.68
PubTator Score 74.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (45)

PMID Text
26542757 Results identified epigenetic inactivation of TNFRSF10C and TNFRSF10D in majority of cervical cancer cases.
26050621 DcRs regulate TRAIL sensitivity at a supracellular level
25980612 Infectious wild type HIV-1 production is restricted by 293T cells over-expressing TNFRSF10D
25003639 This study identified TNFRSF10D DNA methylation status as an independent prognostic biomarker for relapse-free survival and overall mortality in non-metastatic melanoma patients.
24649804 membrane expression more common in endometrioid endometrial cancer than in normal endometrium
24211571 the results presented here claim for a relevant impact of aberrant methylation of decoy receptors in melanoma and allow to understand how the silencing of DcR1 and DcR2 is related to melanomagenesis.
23584885 The membrane expression of the TRAIL receptors DR4, DR5, DcR1 and DcR2 is greater in normal endometrium than endometrioid adenocarcinoma (EAC). The level of the receptors in EAC is not dependent on grading and staging and does not predict survival.
23333304 HIV-1 Vif upregulates the expression of tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain (TNFRSF10D) in Vif-expression T cells
22028813 transcript levels of UCHL1, COL1A2, THBS1 and TNFRSF10D were inversely correlated with promoter methylation
21483669 HIV-1 Vif upregulates the expression of tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain (TNFRSF10D) in Vif-expression T cells
20875141 ANT2 shRNA treatment sensitized MCF7, T47 D, and BT474 cells to TRAIL-induced apoptosis by up-regulating the expression of TRAIL death receptors 4 and 5 (DR4 and DR5) and down-regulating the TRAIL decoy receptor 2 (DcR2).
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20799941 TRAIL receptor-4 expression profiles on T cells might be important in revelation of rheumatoid arthritis pathogenesis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20018172 these results demonstrated that hypoxia-inducible factor 1alpha played a crucial role in regulating the transcription of DcR2.
19948942 Higher levels of TRAIL and the TRAIL decoy receptor, TRAIL R4, were expressed by leukocytes in inflamed human periodontal tissues.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19730199 Results indicate that disc cells, after herniation, undergo apoptotic cell death via the DR5/TRAIL pathway.
19573080 Observational study of gene-disease association. (HuGE Navigator)
18981952 High TRAIL death receptor 4 and decoy receptor 2 expression correlates with significant cell death in pancreatic ductal adenocarcinoma patients.
18980997 DCR2-methylated patients showed significantly poorer 5-year event-free survival in the whole neuroblastoma group (43%
18460741 These data strongly support a recent proposal that a segment at 8p21.3 contains crucial prostate cancer tumor suppressors.
17545522 CASP8, DCR2, and HIN-1 methylation leads to progression of neuroblastoma
17522430 Observational study of gene-disease association. (HuGE Navigator)
16980609 The specificity of DcR1- and DcR2-mediated TRAIL inhibition reveals an additional level of complexity for the regulation of TRAIL signaling.
16934748 TRAIL-R4-beta is a new splice variant of TRAIL-receptor 4 lacking the cysteine rich domain 1
16799475 DCR2 was found positive in 81 and 33% normal, 46 and 10% nodular hyperplasia, 74 and 36% PIN tissues, 87 and 89% low-grade carcinomas, and 100 and 93% high-grade carcinomas
16319225 Preligand assembly domain-mediated ligand-independent association between TRAIL receptor 4 (TR4) and TR2 regulates TRAIL-induced apoptosis.
16174727 HIV-1 Vif upregulates the expression of tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain (TNFRSF10D) in Vif-expression T cells
16046522 HIV-1 Vif upregulates the expression of tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain (TNFRSF10D) in Vif-expression T cells
15990565 HIV-1 Vif upregulates the expression of tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain (TNFRSF10D) in Vif-expression T cells
15921376 Resistance to TRAIL-induced apoptosis in acute myeloid leukemia cells is associated with expression of TRAIL-R4.
15919363 CD8+ lymphocytes and NKT lymphocytes, but not CD4+ lymphocytes, express TRAIL-R4
15916713 TRAIL-R4 but not TRAIL-R3 is the decoy receptor which appeared to influence TRAIL sensitivity in breast cancer cells
15538968 The DcR2 was found to have a truncated and non-functional death domain.
15301860 Observational study of genotype prevalence. (HuGE Navigator)
14999791 Our results demonstrate that DcR1 and DcR2 genes are frequently methylated in various tumor types and aberrant methylation was the cause for silencing of DcR1 and DcR2 expression.
12915532 Respiratory syncytial virus infection strongly up-regulated the expression of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) and its functional receptors death receptor 4 (DR4) and DR5.
12808117 likely to be involved in chronic pancreatitis; pancreatic stellate cells may directly contribute to acinar regression by inducing apoptosis of parenchymal cells in a TRAIL-dependent manner
12488957 Cytotoxicity and apoptosis induced by TRAIL to beta-cell lines CM were inhibited competitively by soluble TRAIL receptors, R1, R2, R3 or R4.
12421985 Enhanced expression of DcR2 promotes peripheral blood eosinophil survival in the airways of allergic asthmatics following segmental antigen challenge.
11844843 TNF-related apoptosis-inducing ligand (TRAIL) is not constitutively expressed in the human brain, whereas both apoptosis-mediating and apoptosis-blocking TRAIL receptors are found on neurons, astrocytes, and oligodendrocytes

AA Sequence

MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPRQDEVPQQTVA      1 - 70
PQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQ     71 - 140
CEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPY    141 - 210
HYLIIIVVLVIILAVVVVGFSCRKKFISYLKGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETL    211 - 280
SNRYLQPTQVSEQEIQGQELAELTGVTVESPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDAS    281 - 350
ATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL                                      351 - 386
//

Text Mined References (55)

PMID Year Title
26542757 2016 Epigenetic inactivation of TRAIL decoy receptors at 8p12-21.3 commonly deleted region confers sensitivity to Apo2L/trail-Cisplatin combination therapy in cervical cancer.
26050621 2016 Decoy receptors block TRAIL sensitivity at a supracellular level: the role of stromal cells in controlling tumour TRAIL sensitivity.
25003639 2014 Association of TNFRSF10D DNA-methylation with the survival of melanoma patients.
24649804 2014 Membrane expression of trail receptors DcR1 and DcR2 in the normal endometrium, endometrial atypical hyperplasia and endometrioid endometrial cancer.
24211571 2013 Impact of DNA methyltransferases on the epigenetic regulation of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor expression in malignant melanoma.
23584885 2013 Membrane expression of TRAIL receptors DR4, DR5, DcR1 and DcR2 in the normal endometrium, atypical endometrial hyperplasia and endometrioid adenocarcinoma: a tissue microarray study.
22028813 2011 Cross-platform array screening identifies COL1A2, THBS1, TNFRSF10D and UCHL1 as genes frequently silenced by methylation in melanoma.
20875141 2010 Short-hairpin RNA-induced suppression of adenine nucleotide translocase-2 in breast cancer cells restores their susceptibility to TRAIL-induced apoptosis by activating JNK and modulating TRAIL receptor expression.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20799941 2010 TRAIL death receptor-4, decoy receptor-1 and decoy receptor-2 expression on CD8+ T cells correlate with the disease severity in patients with rheumatoid arthritis.
20732625 2010 Meta-analysis of genome-wide association studies of attention-deficit/hyperactivity disorder.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20018172 2010 Hypoxia-induced decoy receptor 2 gene expression is regulated via a hypoxia-inducible factor 1alpha-mediated mechanism.
19948942 2010 Inhibition of apoptosis in periodontitis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19730199 2009 DR5 and DcR2 are expressed in human lumbar intervertebral discs.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
18981952 2009 High TRAIL death receptor 4 and decoy receptor 2 expression correlates with significant cell death in pancreatic ductal adenocarcinoma patients.
18980997 2008 Circulating methylated-DCR2 gene in serum as an indicator of prognosis and therapeutic efficacy in patients with MYCN nonamplified neuroblastoma.
18460741 Protein phosphatase and TRAIL receptor genes as new candidate tumor genes on chromosome 8p in prostate cancer.
17545522 2007 Methylation of CASP8, DCR2, and HIN-1 in neuroblastoma is associated with poor outcome.
17522430 2007 Polymorphisms in TRAIL receptor genes and risk of breast cancer in Spanish women.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16980609 2006 Differential inhibition of TRAIL-mediated DR5-DISC formation by decoy receptors 1 and 2.
16934748 2006 TRAIL-R4-beta: a new splice variant of TRAIL-receptor 4 lacking the cysteine rich domain 1.
16799475 2006 Expression of p14ARF, p15INK4b, p16INK4a, and DCR2 increases during prostate cancer progression.
16319225 2005 Preligand assembly domain-mediated ligand-independent association between TRAIL receptor 4 (TR4) and TR2 regulates TRAIL-induced apoptosis.
15921376 2005 TRAIL decoy receptors mediate resistance of acute myeloid leukemia cells to TRAIL.
15919363 Restricted expression of tumor necrosis factor-related apoptosis-inducing ligand receptor 4 in human peripheral blood lymphocytes.
15916713 2005 Surface TRAIL decoy receptor-4 expression is correlated with TRAIL resistance in MCF7 breast cancer cells.
15538968 2004 Following a TRAIL: update on a ligand and its five receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
14999791 2004 Aberrant methylation of trail decoy receptor genes is frequent in multiple tumor types.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12915532 2003 Respiratory syncytial virus infection sensitizes cells to apoptosis mediated by tumor necrosis factor-related apoptosis-inducing ligand.
12808117 2003 In chronic pancreatitis, widespread emergence of TRAIL receptors in epithelia coincides with neoexpression of TRAIL by pancreatic stellate cells of early fibrotic areas.
12488957 2002 TNF-related apoptosis-inducing ligand death pathway-mediated human beta-cell destruction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421985 2002 Differential expression of TRAIL and TRAIL receptors in allergic asthmatics following segmental antigen challenge: evidence for a role of TRAIL in eosinophil survival.
12390973 2002 TRAIL induces death of human oligodendrocytes isolated from adult brain.
11956107 2002 The synthetic retinoid CD437 selectively induces apoptosis in human lung cancer cells while sparing normal human lung epithelial cells.
11844843 2002 Lack of tumor necrosis factor-related apoptosis-inducing ligand but presence of its receptors in the human brain.
11420819 2001 Alternative functions for TRAIL receptors in eosinophils and neutrophils.
10754286 2000 Differential localization and regulation of death and decoy receptors for TNF-related apoptosis-inducing ligand (TRAIL) in human melanoma cells.
10229846 1999 TRAIL (Apo-2L) and TRAIL receptors in human placentas: implications for immune privilege.
9537512 1998 TRUNDD, a new member of the TRAIL receptor family that antagonizes TRAIL signalling.
9430226 1997 The novel receptor TRAIL-R4 induces NF-kappaB and protects against TRAIL-mediated apoptosis, yet retains an incomplete death domain.
9382840 1997 A novel receptor for Apo2L/TRAIL contains a truncated death domain.