Property Summary

NCBI Gene PubMed Count 62
PubMed Score 380.95
PubTator Score 87.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.300 2.0e-03
osteosarcoma -3.215 1.3e-03
juvenile dermatomyositis -1.251 3.0e-11
tuberculosis 1.900 5.8e-05
non-small cell lung cancer -1.438 4.1e-12
lung cancer -2.100 1.0e-02
adult high grade glioma -1.200 1.2e-03
group 4 medulloblastoma -1.100 8.1e-04
pancreatic carcinoma 1.300 2.0e-03
subependymal giant cell astrocytoma 1.430 5.5e-03
axial spondyloarthropathy 1.100 1.5e-02

Gene RIF (39)

PMID Text
26542757 Results identified epigenetic inactivation of TNFRSF10C and TNFRSF10D in majority of cervical cancer cases.
26050621 DcRs regulate TRAIL sensitivity at a supracellular level
25808868 DcR1 upregulation mediates temozolomide resistance.
24649804 membrane expression more common in endometrioid endometrial cancer than in normal endometrium
24534820 DcR1 levels in serum sample which were significantly lower in AMD patients.
24211571 the results presented here claim for a relevant impact of aberrant methylation of decoy receptors in melanoma and allow to understand how the silencing of DcR1 and DcR2 is related to melanomagenesis.
23584885 The membrane expression of the TRAIL receptors DR4, DR5, DcR1 and DcR2 is greater in normal endometrium than endometrioid adenocarcinoma (EAC). The level of the receptors in EAC is not dependent on grading and staging and does not predict survival.
23320456 GATA4 and DcR1 promoter hypermethylation is tumor specific event in glioblastoma but they promoter methylation cannot be considered as a prognostic marker of glioblastoma survival.
22555108 Primary EOC is associated to a lower TRAIL-R3 expression.
21483669 HIV-1 Env-pseudotyped virus-infected monocyte-derived macrophage cells downregulate expression of TRAIL decoy receptors DcR1 and DcR2, and cellular FLICE-inhibitory protein (c-FLIP)
21281967 Data show that about 20% of AML patients highly expressed decoy receptor TRAIL-R3, which was strongly correlated to a shortened overall survival.
20799941 Decoy receptors DcR1 and DcR2 on CD8+ T cells, but not on CD4-positive T cells, are positively correlated with patients' DAS scores.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19936781 Results suggest that DcR1 expression occurs in a subset of endometrial carcinomas and may contribute to resistance to TRAIL-induced apoptosis.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19661294 Low DCR1 is associated with non-small cell lung cancer.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19035483 inactivation of TNFRSF10C by chromosomal deletion and promoter methylation may play an important role in prostate cancer development
18590575 Liver metastases with low DcR1/TNFRSF10C mRNA expression were more likely to present with extrahepatic metastases
18511705 TRAILR3 (TNF-related apoptosis inducing ligand receptor 3) levels were significantly higher in lung parenchyma in subjects with emphysema
18460741 These data strongly support a recent proposal that a segment at 8p21.3 contains crucial prostate cancer tumor suppressors.
18345033 p53 negatively regulates oxaliplatin-mediated TRAIL-induced apoptotic activity through DcR1 upregulation.
17690453 tryptophol induces apoptosis through DR5 and the resistance of PBL to tryptophol-induced apoptosis might be due to competition from DcR1
17522430 Observational study of gene-disease association. (HuGE Navigator)
16980609 The specificity of DcR1- and DcR2-mediated TRAIL inhibition reveals an additional level of complexity for the regulation of TRAIL signaling.
16174727 HIV-1 Env-pseudotyped virus-infected monocyte-derived macrophage cells downregulate expression of TRAIL decoy receptors DcR1 and DcR2, and cellular FLICE-inhibitory protein (c-FLIP)
16046522 HIV-1 Env-pseudotyped virus-infected monocyte-derived macrophage cells downregulate expression of TRAIL decoy receptors DcR1 and DcR2, and cellular FLICE-inhibitory protein (c-FLIP)
15990565 HIV-1 Env-pseudotyped virus-infected monocyte-derived macrophage cells downregulate expression of TRAIL decoy receptors DcR1 and DcR2, and cellular FLICE-inhibitory protein (c-FLIP)
15921376 Resistance to TRAIL-induced apoptosis in acute myeloid leukemia cells is associated with expression of TRAIL-R3.
15916713 TRAIL-R4 but not TRAIL-R3 is the decoy receptor which appeared to influence TRAIL sensitivity in breast cancer cells
15538968 The DcR1 had no death domain and was anchored to the membrane via a glycophosphatidyl inositol tail.
15301860 Observational study of genotype prevalence. (HuGE Navigator)
14999791 Our results demonstrate that DcR1 and DcR2 genes are frequently methylated in various tumor types, and aberrant methylation was the cause for silencing of DcR1 and DcR2 expression.
14623878 cloned and characterized a p53 consensus element located within the first intron of the TRAIL-R3 gene
12808117 likely to be involved in chronic pancreatitis; pancreatic stellate cells may directly contribute to acinar regression by inducing apoptosis of parenchymal cells in a TRAIL-dependent manner
12488957 Cytotoxicity and apoptosis induced by TRAIL to beta-cell lines CM were inhibited competitively by soluble TRAIL receptors, R1, R2, R3 or R4.
12417331 analysis of the transcription initiation sites and promoter structure of the TRAIL-R3 gene
11844843 TNF-related apoptosis-inducing ligand (TRAIL) is not constitutively expressed in the human brain, whereas both apoptosis-mediating and apoptosis-blocking TRAIL receptors are found on neurons, astrocytes, and oligodendrocytes

AA Sequence

MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCT      1 - 70
EGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSN     71 - 140
CTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAE    141 - 210
ETMTTSPGTPAPAAEETMITSPGTPASSHYLSCTIVGIIVLIVLLIVFV                         211 - 259
//

Text Mined References (63)

PMID Year Title
26542757 2016 Epigenetic inactivation of TRAIL decoy receptors at 8p12-21.3 commonly deleted region confers sensitivity to Apo2L/trail-Cisplatin combination therapy in cervical cancer.
26050621 2016 Decoy receptors block TRAIL sensitivity at a supracellular level: the role of stromal cells in controlling tumour TRAIL sensitivity.
25808868 2015 Decoy Receptor DcR1 Is Induced in a p50/Bcl3-Dependent Manner and Attenuates the Efficacy of Temozolomide.
24649804 2014 Membrane expression of trail receptors DcR1 and DcR2 in the normal endometrium, endometrial atypical hyperplasia and endometrioid endometrial cancer.
24534820 2014 Does DcR1 (TNF-related apoptosis-inducing-ligand Receptor 3) have any role in human AMD pathogenesis?
24211571 2013 Impact of DNA methyltransferases on the epigenetic regulation of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor expression in malignant melanoma.
23584885 2013 Membrane expression of TRAIL receptors DR4, DR5, DcR1 and DcR2 in the normal endometrium, atypical endometrial hyperplasia and endometrioid adenocarcinoma: a tissue microarray study.
23320456 2013 GATA4 and DcR1 methylation in glioblastomas.
22555108 2012 TRAIL-R3-related apoptosis: epigenetic and expression analyses in women with ovarian neoplasia.
21281967 2011 High TRAIL-R3 expression on leukemic blasts is associated with poor outcome and induces apoptosis-resistance which can be overcome by targeting TRAIL-R2.
20799941 2010 TRAIL death receptor-4, decoy receptor-1 and decoy receptor-2 expression on CD8+ T cells correlate with the disease severity in patients with rheumatoid arthritis.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20451496 2010 TRAIL upregulates decoy receptor 1 and mediates resistance to apoptosis in insulin-secreting INS-1 cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19936781 2010 DcR1 expression in endometrial carcinomas.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19661294 2009 Cytotoxic effects of camptothecin and cisplatin combined with tumor necrosis factor-related apoptosis-inducing ligand (Apo2L/TRAIL) in a model of primary culture of non-small cell lung cancer.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19035483 2009 Genetic and epigenetic inactivation of TNFRSF10C in human prostate cancer.
18590575 2008 Metastatic susceptibility locus, an 8p hot-spot for tumour progression disrupted in colorectal liver metastases: 13 candidate genes examined at the DNA, mRNA and protein level.
18511705 2008 Increased p53 level, Bax/Bcl-x(L) ratio, and TRAIL receptor expression in human emphysema.
18460741 Protein phosphatase and TRAIL receptor genes as new candidate tumor genes on chromosome 8p in prostate cancer.
18345033 2008 P53-mediated upregulation of DcR1 impairs oxaliplatin/TRAIL-induced synergistic anti-tumour potential in colon cancer cells.
17690453 2007 Tryptophol induces death receptor (DR) 5-mediated apoptosis in U937 cells.
17522430 2007 Polymorphisms in TRAIL receptor genes and risk of breast cancer in Spanish women.
16980609 2006 Differential inhibition of TRAIL-mediated DR5-DISC formation by decoy receptors 1 and 2.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15921376 2005 TRAIL decoy receptors mediate resistance of acute myeloid leukemia cells to TRAIL.
15916713 2005 Surface TRAIL decoy receptor-4 expression is correlated with TRAIL resistance in MCF7 breast cancer cells.
15538968 2004 Following a TRAIL: update on a ligand and its five receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
15207703 2004 Bmx is a downstream Rap1 effector in VEGF-induced endothelial cell activation.
14999791 2004 Aberrant methylation of trail decoy receptor genes is frequent in multiple tumor types.
14623878 2004 Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) decoy receptor TRAIL-R3 is up-regulated by p53 in breast tumor cells through a mechanism involving an intronic p53-binding site.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12808117 2003 In chronic pancreatitis, widespread emergence of TRAIL receptors in epithelia coincides with neoexpression of TRAIL by pancreatic stellate cells of early fibrotic areas.
12488957 2002 TNF-related apoptosis-inducing ligand death pathway-mediated human beta-cell destruction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417331 2002 Transcription initiation sites and promoter structure of the human TRAIL-R3 gene.
12390973 2002 TRAIL induces death of human oligodendrocytes isolated from adult brain.
12136286 2002 Apoptosis-mediating receptor-ligand systems in human retinal pigment epithelial cells.
11859410 2002 Inflammatory cytokine regulation of TRAIL-mediated apoptosis in thyroid epithelial cells.
11848467 Differential expression of TRAIL-R3 and TRAIL-R4 in human pancreatic cancer.
11844843 2002 Lack of tumor necrosis factor-related apoptosis-inducing ligand but presence of its receptors in the human brain.
11753607 2001 Sensitization to TRAIL-induced apoptosis and modulation of FLICE-inhibitory protein in B chronic lymphocytic leukemia by actinomycin D.
11464279 2001 CCNU-dependent potentiation of TRAIL/Apo2L-induced apoptosis in human glioma cells is p53-independent but may involve enhanced cytochrome c release.
11451151 2001 Pancreatic adenocarcinoma cell lines show variable susceptibility to TRAIL-mediated cell death.
11442750 2001 Ultraviolet light downregulates CD95 ligand and TRAIL receptor expression facilitating actinic keratosis and squamous cell carcinoma formation.
11420819 2001 Alternative functions for TRAIL receptors in eosinophils and neutrophils.
11417478 2001 In vitro susceptibility to TRAIL-induced apoptosis of acute leukemia cells in the context of TRAIL receptor gene expression and constitutive NF-kappa B activity.
11396170 Augmented pro-apoptotic effects of TRAIL and proteasome inhibitor in human promonocytic leukemic U937 cells.
11024459 2000 Mechanisms of resistance of normal cells to TRAIL induced apoptosis vary between different cell types.
11001921 2000 Maturation of dendritic cells leads to up-regulation of cellular FLICE-inhibitory protein and concomitant down-regulation of death ligand-mediated apoptosis.
10435597 1999 The antiapoptotic decoy receptor TRID/TRAIL-R3 is a p53-regulated DNA damage-inducible gene that is overexpressed in primary tumors of the gastrointestinal tract.
9613612 1998 APO2 ligand: a novel lethal weapon against malignant glioma?
9551946 1998 Lymphocyte inhibitor of TRAIL (TNF-related apoptosis-inducing ligand): a new receptor protecting lymphocytes from the death ligand TRAIL.
9373179 1997 Characterization of two receptors for TRAIL.
9325248 1997 Identification and molecular cloning of two novel receptors for the cytotoxic ligand TRAIL.
9314565 1997 Cloning and characterization of TRAIL-R3, a novel member of the emerging TRAIL receptor family.
9242611 1997 Control of TRAIL-induced apoptosis by a family of signaling and decoy receptors.
9242610 1997 An antagonist decoy receptor and a death domain-containing receptor for TRAIL.