| Tbio | Tumor necrosis factor receptor superfamily member 10C |
Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count |
|---|---|
| Juvenile arthritis | 124 |
| Disease | Target Count | P-value |
|---|---|---|
| non-small cell lung cancer | 2798 | 4.1e-12 |
| juvenile dermatomyositis | 1189 | 3.0e-11 |
| tuberculosis | 1563 | 5.8e-05 |
| group 4 medulloblastoma | 1875 | 8.1e-04 |
| adult high grade glioma | 2148 | 1.2e-03 |
| osteosarcoma | 7933 | 1.3e-03 |
| pancreatic cancer | 2300 | 2.0e-03 |
| pancreatic carcinoma | 567 | 2.0e-03 |
| subependymal giant cell astrocytoma | 2287 | 5.5e-03 |
| lung cancer | 4473 | 1.0e-02 |
| axial spondyloarthropathy | 28 | 1.5e-02 |
| Disease | log2 FC | p |
|---|---|---|
| pancreatic cancer | 1.300 | 2.0e-03 |
| osteosarcoma | -3.215 | 1.3e-03 |
| juvenile dermatomyositis | -1.251 | 3.0e-11 |
| tuberculosis | 1.900 | 5.8e-05 |
| non-small cell lung cancer | -1.438 | 4.1e-12 |
| lung cancer | -2.100 | 1.0e-02 |
| adult high grade glioma | -1.200 | 1.2e-03 |
| group 4 medulloblastoma | -1.100 | 8.1e-04 |
| pancreatic carcinoma | 1.300 | 2.0e-03 |
| subependymal giant cell astrocytoma | 1.430 | 5.5e-03 |
| axial spondyloarthropathy | 1.100 | 1.5e-02 |
| PMID | Text | |
|---|---|---|
| 26542757 | Results identified epigenetic inactivation of TNFRSF10C and TNFRSF10D in majority of cervical cancer cases. | |
| 26050621 | DcRs regulate TRAIL sensitivity at a supracellular level | |
| 25808868 | DcR1 upregulation mediates temozolomide resistance. | |
| 24649804 | membrane expression more common in endometrioid endometrial cancer than in normal endometrium | |
| 24534820 | DcR1 levels in serum sample which were significantly lower in AMD patients. | |
| 24211571 | the results presented here claim for a relevant impact of aberrant methylation of decoy receptors in melanoma and allow to understand how the silencing of DcR1 and DcR2 is related to melanomagenesis. | |
| 23584885 | The membrane expression of the TRAIL receptors DR4, DR5, DcR1 and DcR2 is greater in normal endometrium than endometrioid adenocarcinoma (EAC). The level of the receptors in EAC is not dependent on grading and staging and does not predict survival. | |
| 23320456 | GATA4 and DcR1 promoter hypermethylation is tumor specific event in glioblastoma but they promoter methylation cannot be considered as a prognostic marker of glioblastoma survival. | |
| 22555108 | Primary EOC is associated to a lower TRAIL-R3 expression. | |
| 21483669 | HIV-1 Env-pseudotyped virus-infected monocyte-derived macrophage cells downregulate expression of TRAIL decoy receptors DcR1 and DcR2, and cellular FLICE-inhibitory protein (c-FLIP) | |
| 21281967 | Data show that about 20% of AML patients highly expressed decoy receptor TRAIL-R3, which was strongly correlated to a shortened overall survival. | |
| 20799941 | Decoy receptors DcR1 and DcR2 on CD8+ T cells, but not on CD4-positive T cells, are positively correlated with patients' DAS scores. | |
| 20568250 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20237496 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19936781 | Results suggest that DcR1 expression occurs in a subset of endometrial carcinomas and may contribute to resistance to TRAIL-induced apoptosis. | |
| 19773279 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19661294 | Low DCR1 is associated with non-small cell lung cancer. | |
| 19573080 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19035483 | inactivation of TNFRSF10C by chromosomal deletion and promoter methylation may play an important role in prostate cancer development | |
| 18590575 | Liver metastases with low DcR1/TNFRSF10C mRNA expression were more likely to present with extrahepatic metastases | |
| 18511705 | TRAILR3 (TNF-related apoptosis inducing ligand receptor 3) levels were significantly higher in lung parenchyma in subjects with emphysema | |
| 18460741 | These data strongly support a recent proposal that a segment at 8p21.3 contains crucial prostate cancer tumor suppressors. | |
| 18345033 | p53 negatively regulates oxaliplatin-mediated TRAIL-induced apoptotic activity through DcR1 upregulation. | |
| 17690453 | tryptophol induces apoptosis through DR5 and the resistance of PBL to tryptophol-induced apoptosis might be due to competition from DcR1 | |
| 17522430 | Observational study of gene-disease association. (HuGE Navigator) | |
| 16980609 | The specificity of DcR1- and DcR2-mediated TRAIL inhibition reveals an additional level of complexity for the regulation of TRAIL signaling. | |
| 16174727 | HIV-1 Env-pseudotyped virus-infected monocyte-derived macrophage cells downregulate expression of TRAIL decoy receptors DcR1 and DcR2, and cellular FLICE-inhibitory protein (c-FLIP) | |
| 16046522 | HIV-1 Env-pseudotyped virus-infected monocyte-derived macrophage cells downregulate expression of TRAIL decoy receptors DcR1 and DcR2, and cellular FLICE-inhibitory protein (c-FLIP) | |
| 15990565 | HIV-1 Env-pseudotyped virus-infected monocyte-derived macrophage cells downregulate expression of TRAIL decoy receptors DcR1 and DcR2, and cellular FLICE-inhibitory protein (c-FLIP) | |
| 15921376 | Resistance to TRAIL-induced apoptosis in acute myeloid leukemia cells is associated with expression of TRAIL-R3. | |
| 15916713 | TRAIL-R4 but not TRAIL-R3 is the decoy receptor which appeared to influence TRAIL sensitivity in breast cancer cells | |
| 15538968 | The DcR1 had no death domain and was anchored to the membrane via a glycophosphatidyl inositol tail. | |
| 15301860 | Observational study of genotype prevalence. (HuGE Navigator) | |
| 14999791 | Our results demonstrate that DcR1 and DcR2 genes are frequently methylated in various tumor types, and aberrant methylation was the cause for silencing of DcR1 and DcR2 expression. | |
| 14623878 | cloned and characterized a p53 consensus element located within the first intron of the TRAIL-R3 gene | |
| 12808117 | likely to be involved in chronic pancreatitis; pancreatic stellate cells may directly contribute to acinar regression by inducing apoptosis of parenchymal cells in a TRAIL-dependent manner | |
| 12488957 | Cytotoxicity and apoptosis induced by TRAIL to beta-cell lines CM were inhibited competitively by soluble TRAIL receptors, R1, R2, R3 or R4. | |
| 12417331 | analysis of the transcription initiation sites and promoter structure of the TRAIL-R3 gene | |
| 11844843 | TNF-related apoptosis-inducing ligand (TRAIL) is not constitutively expressed in the human brain, whereas both apoptosis-mediating and apoptosis-blocking TRAIL receptors are found on neurons, astrocytes, and oligodendrocytes |
MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCT 1 - 70 EGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSN 71 - 140 CTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAE 141 - 210 ETMTTSPGTPAPAAEETMITSPGTPASSHYLSCTIVGIIVLIVLLIVFV 211 - 259 //
| PMID | Year | Title | |
|---|---|---|---|
| 26542757 | 2016 | Epigenetic inactivation of TRAIL decoy receptors at 8p12-21.3 commonly deleted region confers sensitivity to Apo2L/trail-Cisplatin combination therapy in cervical cancer. | |
| 26050621 | 2016 | Decoy receptors block TRAIL sensitivity at a supracellular level: the role of stromal cells in controlling tumour TRAIL sensitivity. | |
| 25808868 | 2015 | Decoy Receptor DcR1 Is Induced in a p50/Bcl3-Dependent Manner and Attenuates the Efficacy of Temozolomide. | |
| 24649804 | 2014 | Membrane expression of trail receptors DcR1 and DcR2 in the normal endometrium, endometrial atypical hyperplasia and endometrioid endometrial cancer. | |
| 24534820 | 2014 | Does DcR1 (TNF-related apoptosis-inducing-ligand Receptor 3) have any role in human AMD pathogenesis? | |
| 24211571 | 2013 | Impact of DNA methyltransferases on the epigenetic regulation of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor expression in malignant melanoma. | |
| 23584885 | 2013 | Membrane expression of TRAIL receptors DR4, DR5, DcR1 and DcR2 in the normal endometrium, atypical endometrial hyperplasia and endometrioid adenocarcinoma: a tissue microarray study. | |
| 23320456 | 2013 | GATA4 and DcR1 methylation in glioblastomas. | |
| 22555108 | 2012 | TRAIL-R3-related apoptosis: epigenetic and expression analyses in women with ovarian neoplasia. | |
| 21281967 | 2011 | High TRAIL-R3 expression on leukemic blasts is associated with poor outcome and induces apoptosis-resistance which can be overcome by targeting TRAIL-R2. | |
| 20799941 | 2010 | TRAIL death receptor-4, decoy receptor-1 and decoy receptor-2 expression on CD8+ T cells correlate with the disease severity in patients with rheumatoid arthritis. | |
| 20568250 | 2010 | Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut. | |
| 20451496 | 2010 | TRAIL upregulates decoy receptor 1 and mediates resistance to apoptosis in insulin-secreting INS-1 cells. | |
| 20237496 | 2010 | New genetic associations detected in a host response study to hepatitis B vaccine. | |
| 19936781 | 2010 | DcR1 expression in endometrial carcinomas. | |
| 19773279 | 2009 | Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity. | |
| 19661294 | 2009 | Cytotoxic effects of camptothecin and cisplatin combined with tumor necrosis factor-related apoptosis-inducing ligand (Apo2L/TRAIL) in a model of primary culture of non-small cell lung cancer. | |
| 19573080 | 2009 | Common genetic variants in candidate genes and risk of familial lymphoid malignancies. | |
| 19035483 | 2009 | Genetic and epigenetic inactivation of TNFRSF10C in human prostate cancer. | |
| 18590575 | 2008 | Metastatic susceptibility locus, an 8p hot-spot for tumour progression disrupted in colorectal liver metastases: 13 candidate genes examined at the DNA, mRNA and protein level. | |
| 18511705 | 2008 | Increased p53 level, Bax/Bcl-x(L) ratio, and TRAIL receptor expression in human emphysema. | |
| 18460741 | Protein phosphatase and TRAIL receptor genes as new candidate tumor genes on chromosome 8p in prostate cancer. | ||
| 18345033 | 2008 | P53-mediated upregulation of DcR1 impairs oxaliplatin/TRAIL-induced synergistic anti-tumour potential in colon cancer cells. | |
| 17690453 | 2007 | Tryptophol induces death receptor (DR) 5-mediated apoptosis in U937 cells. | |
| 17522430 | 2007 | Polymorphisms in TRAIL receptor genes and risk of breast cancer in Spanish women. | |
| 16980609 | 2006 | Differential inhibition of TRAIL-mediated DR5-DISC formation by decoy receptors 1 and 2. | |
| 16421571 | 2006 | DNA sequence and analysis of human chromosome 8. | |
| 15921376 | 2005 | TRAIL decoy receptors mediate resistance of acute myeloid leukemia cells to TRAIL. | |
| 15916713 | 2005 | Surface TRAIL decoy receptor-4 expression is correlated with TRAIL resistance in MCF7 breast cancer cells. | |
| 15538968 | 2004 | Following a TRAIL: update on a ligand and its five receptors. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15340161 | 2004 | Signal peptide prediction based on analysis of experimentally verified cleavage sites. | |
| 15301860 | 2004 | Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population. | |
| 15207703 | 2004 | Bmx is a downstream Rap1 effector in VEGF-induced endothelial cell activation. | |
| 14999791 | 2004 | Aberrant methylation of trail decoy receptor genes is frequent in multiple tumor types. | |
| 14623878 | 2004 | Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) decoy receptor TRAIL-R3 is up-regulated by p53 in breast tumor cells through a mechanism involving an intronic p53-binding site. | |
| 12975309 | 2003 | The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. | |
| 12808117 | 2003 | In chronic pancreatitis, widespread emergence of TRAIL receptors in epithelia coincides with neoexpression of TRAIL by pancreatic stellate cells of early fibrotic areas. | |
| 12488957 | 2002 | TNF-related apoptosis-inducing ligand death pathway-mediated human beta-cell destruction. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12417331 | 2002 | Transcription initiation sites and promoter structure of the human TRAIL-R3 gene. | |
| 12390973 | 2002 | TRAIL induces death of human oligodendrocytes isolated from adult brain. | |
| 12136286 | 2002 | Apoptosis-mediating receptor-ligand systems in human retinal pigment epithelial cells. | |
| 11859410 | 2002 | Inflammatory cytokine regulation of TRAIL-mediated apoptosis in thyroid epithelial cells. | |
| 11848467 | Differential expression of TRAIL-R3 and TRAIL-R4 in human pancreatic cancer. | ||
| 11844843 | 2002 | Lack of tumor necrosis factor-related apoptosis-inducing ligand but presence of its receptors in the human brain. | |
| 11753607 | 2001 | Sensitization to TRAIL-induced apoptosis and modulation of FLICE-inhibitory protein in B chronic lymphocytic leukemia by actinomycin D. | |
| 11464279 | 2001 | CCNU-dependent potentiation of TRAIL/Apo2L-induced apoptosis in human glioma cells is p53-independent but may involve enhanced cytochrome c release. | |
| 11451151 | 2001 | Pancreatic adenocarcinoma cell lines show variable susceptibility to TRAIL-mediated cell death. | |
| 11442750 | 2001 | Ultraviolet light downregulates CD95 ligand and TRAIL receptor expression facilitating actinic keratosis and squamous cell carcinoma formation. | |
| 11420819 | 2001 | Alternative functions for TRAIL receptors in eosinophils and neutrophils. | |
| 11417478 | 2001 | In vitro susceptibility to TRAIL-induced apoptosis of acute leukemia cells in the context of TRAIL receptor gene expression and constitutive NF-kappa B activity. | |
| 11396170 | Augmented pro-apoptotic effects of TRAIL and proteasome inhibitor in human promonocytic leukemic U937 cells. | ||
| 11024459 | 2000 | Mechanisms of resistance of normal cells to TRAIL induced apoptosis vary between different cell types. | |
| 11001921 | 2000 | Maturation of dendritic cells leads to up-regulation of cellular FLICE-inhibitory protein and concomitant down-regulation of death ligand-mediated apoptosis. | |
| 10435597 | 1999 | The antiapoptotic decoy receptor TRID/TRAIL-R3 is a p53-regulated DNA damage-inducible gene that is overexpressed in primary tumors of the gastrointestinal tract. | |
| 9613612 | 1998 | APO2 ligand: a novel lethal weapon against malignant glioma? | |
| 9551946 | 1998 | Lymphocyte inhibitor of TRAIL (TNF-related apoptosis-inducing ligand): a new receptor protecting lymphocytes from the death ligand TRAIL. | |
| 9373179 | 1997 | Characterization of two receptors for TRAIL. | |
| 9325248 | 1997 | Identification and molecular cloning of two novel receptors for the cytotoxic ligand TRAIL. | |
| 9314565 | 1997 | Cloning and characterization of TRAIL-R3, a novel member of the emerging TRAIL receptor family. | |
| 9242611 | 1997 | Control of TRAIL-induced apoptosis by a family of signaling and decoy receptors. | |
| 9242610 | 1997 | An antagonist decoy receptor and a death domain-containing receptor for TRAIL. |
