Property Summary

NCBI Gene PubMed Count 55
PubMed Score 41.28
PubTator Score 74.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Protein-protein Interaction (1)

Gene RIF (46)

AA Sequence

MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPRQDEVPQQTVA      1 - 70
PQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQ     71 - 140
CEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPY    141 - 210
HYLIIIVVLVIILAVVVVGFSCRKKFISYLKGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETL    211 - 280
SNRYLQPTQVSEQEIQGQELAELTGVTVESPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDAS    281 - 350
ATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL                                      351 - 386
//

Text Mined References (56)

PMID Year Title