Property Summary

NCBI Gene PubMed Count 19
PubMed Score 47.96
PubTator Score 18.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
hepatocellular carcinoma 550 8.3e-06
osteosarcoma 7933 1.1e-05
pancreatic cancer 2300 2.5e-03
pancreatic carcinoma 567 2.5e-03

Synonym

Accession Q6P589 Q6I9Y0 Q9H2H7 Q9H5G2 TIPE2
Symbols TIPE2

PDB

3F4M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (16)

PMID Text
26530498 The TIPE2-elicited antimetastatic effect in gastric cancer was closely associated with the inhibition of AKT signaling and enhancement of GSK3b activity followed by the degradation and decreased translocation to nucleus of b-catenin
26426653 TIPE2 mRNA showed sensitivity of 74.63%, specificity of 90.24%, positive predictive value of 92.5%, and negative predictive value of 67.3% for predicting 3-month mortality in Acute-on-Chronic Hepatitis B Liver Failure.
25946186 TIPE2 promoted lung cancer cell apoptosis through affecting apoptosis-related molecules caspase-3, caspase-9, Bcl-2 and Bax, possibly via regulating P38 and Akt pathways.
25542151 TIPE2 might serve as a tumor suppressor in non-small cell lung cancer progression.
25536447 Tumor necrosis factor-alpha-induced protein-8 like-2 (TIPE2) upregulates p27 to decrease gastic cancer cell proliferation
25499447 TIPE2 plays an important role in regulating hepatitis B virus-specific CD8(+) T cell functions in patients with hepatitis B.
25339267 Both TNF-alpha and TIPE2 might be potential targets for the treatment of hepatocellular carcinoma metastasis.
24934366 TIPE2 can inhibit caspase-8 activity in colon cancer cells. TIPE2 can regulate TLR4 inflammatory effect and inhibit further amplification of cascade reaction via caspase-8.
24806446 These results strongly suggest that TIPE2 plays an important role in shifting L-arginase metabolism from production of NO to urea, during host inflammatory response.
24274578 Human TIPE2 is an endogenous inhibitor of Rac1 in hepatocellular carcinoma (HCC) by which it attenuates invasion and metastasis of HCC.
24107080 TIPE2 mRNA and protein expression were decreased in children with asthma compared with healthy controls.
23009108 Letter: detection of TIPE2 in the blood samples may be used as one of the diagnosis molecular markers in clinical monitoring kidney chronic rejection.
22326055 TIPE2 is an inhibitor of both inflammation and cancer, and a potential drug target for inflammatory and neoplastic diseases.
21466895 These results indicate that TIPE2 plays an important role in taming Hepatitis B virus-induced hepatic inflammation.
21459448 The unique expressional profile of human TIPE2 suggests new functions beyond controlling innate and adaptive immunity.
20663561 High levels of TIPE2 were detected in monocyte/macrophage derived cell lines and ovarian adenocarcinoma cells, but not detectable or weakly expressed in most human carcinoma cell lines.

AA Sequence

MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKV      1 - 70
AVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSH     71 - 140
GRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL                              141 - 184
//

Text Mined References (25)

PMID Year Title
26530498 2016 TIPE2 functions as a metastasis suppressor via negatively regulating ?-catenin through activating GSK3? in gastric cancer.
26426653 2015 TIPE2 mRNA Level in PBMCs Serves as a Novel Biomarker for Predicting Short-Term Mortality of Acute-on-Chronic Hepatitis B Liver Failure: A Prospective Single-Center Study.
25946186 2015 TIPE2 Inhibits Lung Cancer Growth Attributing to Promotion of Apoptosis by Regulating Some Apoptotic Molecules Expression.
25542151 2015 Downregulated TIPE2 is associated with poor prognosis and promotes cell proliferation in non-small cell lung cancer.
25536447 2015 Tumor necrosis factor-?-induced protein-8 like-2 (TIPE2) upregulates p27 to decrease gastic cancer cell proliferation.
25499447 2015 TIPE2 protein negatively regulates HBV-specific CD8? T lymphocyte functions in humans.
25339267 2015 TIPE2 inhibits TNF-?-induced hepatocellular carcinoma cell metastasis via Erk1/2 downregulation and NF-?B activation.
24934366 2014 A novel inflammatory regulator TIPE2 inhibits TLR4-mediated development of colon cancer via caspase-8.
24806446 2014 TIPE2 negatively regulates inflammation by switching arginine metabolism from nitric oxide synthase to arginase.
24274578 2013 Human tumor necrosis factor (TNF)-alpha-induced protein 8-like 2 suppresses hepatocellular carcinoma metastasis through inhibiting Rac1.
24107080 2013 The expression and significance of TIPE2 in peripheral blood mononuclear cells from asthmatic children.
23009108 2013 TIPE2, a novel biomarker for clinical chronic kidney allograft rejection.
22326055 2012 The anti-inflammatory TIPE2 is an inhibitor of the oncogenic Ras.
21924498 2011 The TIPE (TNFAIP8) family in inflammation, immunity, and cancer.
21466895 2011 Roles of TIPE2 in hepatitis B virus-induced hepatic inflammation in humans and mice.
21459448 2011 The unique expression profile of human TIPE2 suggests new functions beyond its role in immune regulation.
20663561 2010 Tissue-specific expression of TIPE2 provides insights into its function.
19079267 2009 Crystal structure of TIPE2 provides insights into immune homeostasis.
18455983 2008 TIPE2, a negative regulator of innate and adaptive immunity that maintains immune homeostasis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.