Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.62
PubTator Score 11.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.600 3.7e-03
ependymoma -2.500 1.2e-02
oligodendroglioma -2.300 1.1e-02
osteosarcoma -1.533 8.4e-04
medulloblastoma -2.100 6.3e-05
atypical teratoid / rhabdoid tumor -1.600 4.3e-05
glioblastoma -1.400 1.2e-04
medulloblastoma, large-cell -2.600 4.9e-05
primitive neuroectodermal tumor -1.700 1.2e-03
pancreatic ductal adenocarcinoma liver m... -1.126 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.500 2.3e-02
interstitial cystitis 1.100 7.4e-04
adult high grade glioma -1.300 1.0e-02
nasopharyngeal carcinoma -1.300 7.5e-05
Breast cancer 1.400 5.8e-11
gastric carcinoma 1.200 2.6e-02
ovarian cancer 1.100 4.3e-06

Synonym

Accession Q8WVP5 D6W627 TIPE1
Symbols TIPE1

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
25043299 TIPE1 induced apoptosis in HCC cells by negatively regulating Rac1 pathway
24444419 oxidative stress induces Tnfaip8 l1/Oxi-beta, which results in increased autophagy by its exclusive binding with FBXW5 to stabilize TSC2
21600655 high levels of TIPE1 (TNFAIP8-like 1) mRNA were detected in most human carcinoma cell lines, especially in cells transformed with viral genomes

AA Sequence

MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKL      1 - 70
GLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSH     71 - 140
GRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL                            141 - 186
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25043299 2015 TIPE1 induces apoptosis by negatively regulating Rac1 activation in hepatocellular carcinoma cells.
24444419 2014 Tnfaip8 l1/Oxi-? binds to FBXW5, increasing autophagy through activation of TSC2 in a Parkinson's disease model.
21924498 2011 The TIPE (TNFAIP8) family in inflammation, immunity, and cancer.
21600655 2011 The expression of TIPE1 in murine tissues and human cell lines.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.