Property Summary

NCBI Gene PubMed Count 37
PubMed Score 35.22
PubTator Score 31.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma 1.100 1.5e-02
Astrocytoma, Pilocytic 1.100 8.8e-05
atypical teratoid / rhabdoid tumor 1.600 6.4e-03
Bipolar Disorder 1.314 4.4e-02
chronic kidney disease 1.600 3.2e-02
dermatomyositis 1.200 1.3e-02
ependymoma 1.100 3.4e-05
glioblastoma 1.100 8.6e-04
intraductal papillary-mucinous adenoma (... 1.400 2.8e-02
juvenile dermatomyositis 1.034 1.5e-06
lung cancer -1.100 1.0e-02
lung carcinoma -1.400 1.1e-23
Multiple myeloma 1.641 1.3e-02
osteosarcoma -1.470 9.6e-03
ovarian cancer -2.700 2.0e-06
primary Sjogren syndrome 2.300 1.0e-04
primitive neuroectodermal tumor 1.200 4.1e-03
psoriasis 1.500 3.2e-04
sarcoidosis 1.400 2.9e-02
sonic hedgehog group medulloblastoma 1.300 9.3e-03
subependymal giant cell astrocytoma 2.044 2.6e-02
tuberculosis -1.700 1.7e-06
ulcerative colitis 2.100 1.4e-06
Waldenstrons macroglobulinemia 1.484 8.2e-03

Gene RIF (25)

AA Sequence

MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEK      1 - 70
IIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLH     71 - 140
QIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI                141 - 198
//

Text Mined References (42)

PMID Year Title