Property Summary

NCBI Gene PubMed Count 28
PubMed Score 38.45
PubTator Score 31.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.644 5.9e-03
Multiple myeloma 1.836 1.0e-02
psoriasis 1.700 7.1e-05
glioblastoma 1.900 2.8e-03
osteosarcoma -3.793 6.7e-12
posterior fossa group A ependymoma 1.600 8.1e-06
atypical teratoid / rhabdoid tumor 1.600 6.4e-03
primitive neuroectodermal tumor 1.200 4.1e-03
juvenile dermatomyositis 1.034 1.5e-06
chronic kidney disease 1.700 3.6e-02
tuberculosis -1.700 1.7e-06
intraductal papillary-mucinous adenoma (... 1.400 2.8e-02
lung cancer -1.800 2.3e-05
sarcoidosis 1.500 3.2e-02
pediatric high grade glioma 1.200 5.1e-04
pilocytic astrocytoma 1.300 8.2e-05
sonic hedgehog group medulloblastoma 1.600 4.0e-03
primary Sjogren syndrome 2.300 1.0e-04
subependymal giant cell astrocytoma 2.044 2.6e-02
lung carcinoma -1.400 1.1e-23
Bipolar Disorder 1.314 4.4e-02
ulcerative colitis 2.400 1.1e-06
ovarian cancer -3.100 4.7e-07
dermatomyositis 1.200 1.3e-02

Gene RIF (16)

PMID Text
25936980 Expression of TNFAIP8 is up-regulated in human gastric cancer and regulates cell proliferation, invasion and migration.
24767861 our findings indicate that TNFAIP8 overexpression is an independent predictor of platinum resistance in epithelial ovarian cancer
24621012 Our data suggest that TNFAIP8 overexpression may contribute to lymph node metastasis and poor prognosis in intestinal-type gastric adenocarcinoma.
24590269 TNFAIP8 may be used as a prognostic marker for the recurrence of endometrial cancer (EC), and its promotion of the proliferation and metastasis in EC may be due to its mediation of Ki-67 and MMP9.
24464924 SCC-S2 may play roles in affecting both immune cells and tumor cells in the thyroid and may indicate a novel pathway for understanding the pathogenesis of the disease.
24162774 HIV-1 gp120 upregulates the expression of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8) in human B cells
24136748 These results provide evidence that TNFAIP8 plays critical roles in non-small cell lung cancer
23299407 the TNFAIP8-rs11064 Single nucleotide polymorphism may function by affecting the affinity of miR-22 binding to the 3'-untranslated region of TNFAIP8 and regulating TNFAIP8 expression, thus contributing to cervical cancer risk
23280553 TNFAIP8 functions in oncogenesis are likely to involve activation of the integrin, MMP and VEGFR-2 signaling pathways. TNFAIP8 expression revealed correlation of both cytoplasmic and nuclear TNFAIP8 overexpression with high grade prostatic adenocarcinomas
22886548 SCC-S2 is overexpressed in colon cancers.
22666399 polymorphism of TNFAIP8 rs1045241C>T may contribute to NHL susceptibility in a Chinese population
22631659 results showed stronger staining of TNFAIP8 protein in pancreatic cancer tissues compared with normal pancreas tissue; TNFAIP8 expression positively correlated with EGFR levels; results indicate TNFAIP8 may play important roles in the progression of pancreatic cancer
20699119 Findings demonstrate that TNFAIP8 is one of critical components of a signal transduction pathway that links mesangial cell proliferation to diabetic renal injury.
20398053 SCC-S2 plays an important role in NSCLC and might be a useful therapeutic target of NSCLC.
19112178 A chicken ovalbumin upstream promoter transcription factor I (COUP-TFI) complex represses expression of the gene encoding tumor necrosis factor alpha-induced protein 8 (TNFAIP8).
14724590 SCC-S2 is a novel oncogenic factor in cancer cells

AA Sequence

MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEK      1 - 70
IIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLH     71 - 140
QIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI                141 - 198
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25936980 2015 Expression of tumor necrosis factor ?-induced protein 8 is upregulated in human gastric cancer and regulates cell proliferation, invasion and migration.
25416956 2014 A proteome-scale map of the human interactome network.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24767861 2014 TNFAIP8 overexpression is associated with platinum resistance in epithelial ovarian cancers with optimal cytoreduction.
24621012 2014 TNFAIP8 overexpression is associated with lymph node metastasis and poor prognosis in intestinal-type gastric adenocarcinoma.
24590269 2014 Correlation of TNFAIP8 overexpression with the proliferation, metastasis, and disease-free survival in endometrial cancer.
24464924 2014 Upregulation of SCC-S2 in immune cells and tumor tissues of papillary thyroid carcinoma.
24136748 2014 Variance of TNFAIP8 expression between tumor tissues and tumor-infiltrating CD4+ and CD8+ T cells in non-small cell lung cancer.
23299407 2013 Functional variants in TNFAIP8 associated with cervical cancer susceptibility and clinical outcomes.
23280553 2013 The significance of TNFAIP8 in prostate cancer response to radiation and docetaxel and disease recurrence.
22886548 2012 SCC-S2 is overexpressed in colon cancers and regulates cell proliferation.
22666399 2012 Tumor necrosis factor-? induced protein 8 polymorphism and risk of non-Hodgkin's lymphoma in a Chinese population: a case-control study.
22631659 2012 Expression of tumor necrosis factor-alpha-induced protein 8 in pancreas tissues and its correlation with epithelial growth factor receptor levels.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20699119 2010 Expression and regulation of a novel identified TNFAIP8 family is associated with diabetic nephropathy.
20398053 2010 Overexpression of SCC-S2 correlates with lymph node metastasis and poor prognosis in patients with non-small-cell lung cancer.
19112178 2009 A chicken ovalbumin upstream promoter transcription factor I (COUP-TFI) complex represses expression of the gene encoding tumor necrosis factor alpha-induced protein 8 (TNFAIP8).
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14724590 2004 Expression of SCC-S2, an antiapoptotic molecule, correlates with enhanced proliferation and tumorigenicity of MDA-MB 435 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11346652 2001 Nuclear factor-kappa B-inducible death effector domain-containing protein suppresses tumor necrosis factor-mediated apoptosis by inhibiting caspase-8 activity.
10644768 2000 Identification of a novel tumor necrosis factor-alpha-inducible gene, SCC-S2, containing the consensus sequence of a death effector domain of fas-associated death domain-like interleukin- 1beta-converting enzyme-inhibitory protein.
10233894 1999 Vascular endothelial genes that are responsive to tumor necrosis factor-alpha in vitro are expressed in atherosclerotic lesions, including inhibitor of apoptosis protein-1, stannin, and two novel genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.