Property Summary

NCBI Gene PubMed Count 310
PubMed Score 259.20
PubTator Score 251.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Neoplastic Cell Transformation 89
Disease Target Count Z-score Confidence
Juvenile rheumatoid arthritis 111 0.0 5.0

Expression

  Differential Expression (30)

Disease log2 FC p
Rheumatoid arthritis 1.700 8.8e-03
lung cancer -3.500 3.8e-05
psoriasis 1.100 5.2e-03
active ulcerative colitis 1.085 1.0e-02
acute myeloid leukemia 2.200 2.1e-03
adult high grade glioma 2.300 1.3e-05
Astrocytoma, Pilocytic 1.800 1.0e-08
atypical teratoid / rhabdoid tumor 2.300 4.7e-05
Bipolar Disorder 1.807 2.0e-02
chronic rhinosinusitis -1.981 2.2e-02
cutaneous lupus erythematosus 1.400 6.1e-03
cystic fibrosis 1.426 1.9e-03
diabetes mellitus -1.100 3.4e-02
ependymoma 2.100 7.8e-07
esophageal adenocarcinoma 1.600 4.2e-02
gastric carcinoma 1.700 3.2e-02
glioblastoma 2.200 4.7e-10
interstitial cystitis 1.400 9.9e-03
lung adenocarcinoma -1.291 2.6e-05
lung carcinoma -3.000 2.0e-17
malignant mesothelioma -3.400 6.3e-08
medulloblastoma 1.300 2.0e-05
non-small cell lung cancer -1.071 5.1e-07
ovarian cancer 1.300 4.2e-03
pancreatic ductal adenocarcinoma liver m... 1.349 1.6e-02
pituitary cancer -1.500 3.8e-04
primitive neuroectodermal tumor 1.200 8.4e-04
spina bifida -1.900 3.0e-02
subependymal giant cell astrocytoma 1.782 4.2e-02
tuberculosis -1.500 3.4e-05

PDB (18)

Gene RIF (280)

AA Sequence

MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALID      1 - 70
RNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKF     71 - 140
RWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVI    141 - 210
SDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDR    211 - 280
GRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQ    281 - 350
HEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK    351 - 420
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQ    421 - 490
HNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCH    491 - 560
QRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIE    561 - 630
YRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQ    631 - 700
RRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHF    701 - 770
GNAKCNGYCNECFQFKQMYG                                                      771 - 790
//

Text Mined References (321)

PMID Year Title