Property Summary

NCBI Gene PubMed Count 276
PubMed Score 236.56
PubTator Score 251.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Juvenile rheumatoid arthritis 105 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 3.468 1.7
Psoriatic arthritis 85 3.324 1.7
Blind loop syndrome 2 3.269 1.6

Expression

  Differential Expression (30)

Disease log2 FC p
Rheumatoid Arthritis 1.700 8.8e-03
psoriasis -1.700 2.7e-06
malignant mesothelioma -3.400 6.3e-08
esophageal adenocarcinoma 1.600 4.2e-02
cutaneous lupus erythematosus 1.400 6.1e-03
posterior fossa group A ependymoma 2.700 4.8e-09
glioblastoma 2.400 1.7e-05
cystic fibrosis 1.426 1.9e-03
atypical teratoid/rhabdoid tumor 2.400 6.7e-07
medulloblastoma 1.300 2.0e-05
primitive neuroectodermal tumor 1.600 1.0e-04
tuberculosis -1.500 3.4e-05
pancreatic ductal adenocarcinoma liver m... 1.349 1.6e-02
non-small cell lung cancer -1.071 5.1e-07
lung cancer -4.800 7.7e-06
ulcerative colitis 1.600 3.0e-05
diabetes mellitus -1.100 3.4e-02
interstitial cystitis 1.600 4.7e-03
adult high grade glioma 2.300 1.3e-05
pilocytic astrocytoma 1.800 1.2e-08
subependymal giant cell astrocytoma 2.311 1.1e-02
lung adenocarcinoma -1.291 2.6e-05
lung carcinoma -3.000 2.0e-17
spina bifida -1.900 3.0e-02
gastric carcinoma 2.000 1.8e-02
Bipolar Disorder 1.807 2.0e-02
acute myeloid leukemia 2.200 2.1e-03
ovarian cancer 2.000 1.8e-04
pituitary cancer -1.500 3.8e-04
chronic rhinosinusitis -1.981 2.2e-02

Gene RIF (247)

PMID Text
26802121 Recruitment of A20 to the C-terminal domain of NEMO represents a novel mechanism limiting NF-kappaB activation by NEMO, and its absence results in autoinflammatory disease.
26758190 By using bioinformatics analysis tool (Targetscan), the 3' untranslated region (3'UTR) of A20 gene was found to be a target of miR-125a. The expression level of miR-125a in pancreatic cancer tissues from chemo-sensitive patients was significantly lower than that from chemo-resistant patients, and was inversely correlated with the A20 mRNA.
26738398 Data suggest that tumour necrosis factor alpha-induced protein 3 (TNFAIP3) and TNFAIP3-interacting protein 1 (TNIP1) single nucleotide polymorphisms (SNPs) confer increased risk of psoriasis in ethnic South Indian Tamils.
26724675 A20 acts as a regulator of the ectodysplasin-A1 pathway to NF-kappaB activation in primary Sjogren's syndrome salivary glands epithelial cells
26716984 There was no significant difference in PFS and OS in patients with or without A20 mutations.
26679293 downregulated expression in B-lymphocytes of patients with lymphoma in Sjogren's syndrome
26652732 we identify the single nucleotide polymorphism rs2327832 of TNFAIP3 as a possible prognostic marker for diabetes outcome in children with T1D.
26642243 Loss-of-function mutations in TNFAIP3 leading to A20 haploinsufficiency cause an early-onset autoinflammatory disease.
26598072 Studied the potential prognostic value of the TNFAIP3-SNP in esophageal cancer.
26561336 knockdown of A20 in tumor site inhibited tumor growth at least through inducing the apoptosis of MDSCs. A20 might be a potential target in anticancer therapy.
26485275 Increased A20 expression is associated with cholangiocarcinoma.
26474180 Our findings indicate that a genetic variant of TNFAIP3 is strongly associated with the silica-induced profibrotic response of fibroblasts.
26437781 A20 targets caspase-8 and FADD to protect HTLV-I-infected cells.
26426612 increased expression on monocytes associated with the severity of acute-on-chronic hepatitis B liver failure
26382585 Hepatitis C virus antigen stimulation up-regulates A20/A20-binding inhibitor of NF-kappaB binding protein expression, which consequently contributes to inefficient M1 macrophage polarization.
26367773 FOXP1, TP53INP1, TNFAIP3, and TUSC2 were identified as miR-19a targets.
26339029 the farming environment protects from allergy by modifying the communication between barrier epithelial cells and dendritic cells through A20 induction.
26338037 Germline rs2230926 missense polymorphism was associated with primary Sjogren's syndrome-associated lymphoma. [meta-analysis]
26199174 TNFAIP3 mutations represent recurrent genetic lesions in T-LGL that affect about 8% of cases, likely contributing to deregulated NF-kappaB activity in this leukemia.
26159495 Up-regulated A20 promotes proliferation, regulates cell cycle progression and induces chemotherapy resistance of acute lymphoblastic leukemia cells.
26143186 Significantly lower A20 expression was found in rheumatoid arthritis patients.
26107748 After TNF-alpha treatment, the A20 expression in SLE monocytes was not markedly altered compared with the untreated SLE monocytes; moreover, the SLE monocytes expressed significantly lower A20 than healthy monocytes with TNF-alpha treatment at each time point.
26005883 Genetic variants of the genes JAK1 and the TNFAIP3 were not associated with Behcet's disease in a Spanish population.
25993287 a miR-125a/A20-initiated and caspase-8-targeted mechanism by which HBx modulates apoptotic signaling, is reported.
25956706 Patients with Crohn disease were characterized as having decreased median expression of TNFAIP3.
25911380 Data suggest that the seventh zinc finger motif of A20 plays important role in NFkappaB-mediated apoptosis induced by tumor necrosis factor-alpha; A20 appears to bind and thus down-regulate inhibitor of apoptosis proteins cIAP1/2.
25890346 TNFAIP3 rs2230926 polymorphism is not suggested to be associated with the susceptibility of chronic HBV infection.
25856582 These data suggest that A20 contributes to tumor formation in a significant fraction of myeloma patients
25806576 Data suggest an association of TNFAIP3 SNPs with susceptibility to chronic ITP. Together with previous reports, finding provides further evidence for TNFAIP3 being a general autoimmunity gene.
25684197 polymorphisms in both TNFAIP3 and TNFRSF1A genes play a role in MS pathogenesis.
25683052 MicroRNA profiling of Mtb-infected macrophages revealed the downregulation of miR-let-7f in a manner dependent on the Mtb secreted effector ESAT-6 leading to A20 increase, a feedback inhibitor of the NF-kappaB pathway.
25674272 our results indicated that the genetic polymorphism of rs2230926 in TNFAIP3 may be a susceptible factor conferring risk for rheumatoid arthritis in southern Chinese Han population.
25631139 Since TNIP1 may facilitate the function of TNFAIP3 in the negative feedback regulation of NF-kappaB activation [5], the corresponding transcript levels of TNIP1 in psoriasis vul- garis were investigated in this study.
25521225 TNFAIP3 polymorphisms are associated with the susceptibility to multiple autoimmune diseases (AIDs) including psoriasis, systemic lupus erythematosus, rheumatoid arthritis, systemic sclerosis and celiac disease.
25496073 rs610604 in the TNFAIP3 gene not only plays important roles in the susceptibility of psoriasis vulgaris, but also contributes to the complex phenotypes of psoriasis vulgaris.
25451900 decreased expression of A20 in PBMCs may be involved in the pathogenesis of diabetes, and targeting A20 may offer a potential therapeutic tool in the treatment of diabetes.
25406098 Replicating the association of single-nucleotide polymorphisms in the TNFAIP3, IL12B and IL23R genes with psoriasis vulgaris, in subjects from different ethnic backgrounds, underlines their importance in the pathogenesis of the disease.
25384343 Overexpression of CARMA-BCL10-MALT in T-ALL may contribute to the constitutive cleavage and inactivation of A20, which enhances NF-kappaB signaling and may be related to T-ALL pathogenesis.
25354935 The TNFAIP3-SNP allows risk stratification of esophageal cancer patients and may be a useful tool to identify patients eligible for multimodal therapy concepts.
25337792 TNFAIP3 and IRF5 polymorphisms were associated with polymyositis/dermatomyositis in Chinese Han patients with interstitial lung disease.
25302371 A review of studies that explored association between TNFAIP3/A20 SNPs and human autoimmune and inflammatory diseases.
25264125 The aim of this study was to investigate whether the HCP5, TNIP1, TNFAIP3, SPATA2 and COG6 genes were genetic risk factors for psoriasis in Chinese population.
25230785 These results suggest that the crosstalk of A20 and NF-kappaB may contribute to HR-HPV-associated tumor growth and metastasis of SCC and may be a novel therapeutic target for SCC in the future.
25217635 A20 has a novel atheroprotective function in vascular cells through modulation of IFNgamma/STAT1 signaling in an IFNbeta-dependent, but NF-kappaB-independent, manner
25190567 The findings identify A20 as a mediator of adiponectin anti-inflammatory action in white adipose tissue and a potential target for mitigating obesity-related pathology.
25050625 The rs5029924 polymorphism in the TNFAIP3 promoter may alter the risk of systemic inflammatory response syndrome in acute pancreatitis patients by influencing the expression of A20 protein.
25034154 Mutations in TNFAIP3 can alter ubiquitin patterns, resulting in improper degradation targeting and termination of proinflammatory responses through NFkB signaling.
25024217 The tumor necrosis factor alpha-induced protein 3 (TNFAIP3, A20) imposes a brake on antitumor activity of CD8 T cells.
24971370 Significantly lower A20 expression was found in rheumatoid arthritis patients as compared with those in the healthy group, while NF-kappaB overexpression could be detected in patients with rheumatoid arthritis.
24965710 These findings suggest that A20 plays a crucial role in negative regulation of innate immune responses during chronic viral infection.
24953694 Together, the findings indicate a new role of miR-29c in IAV infection and suggest its induction may contribute to counteract the innate immune response.
24901050 GBM cells overexpressing TNFAIP3 and NKIRAS2 were refractory to miR-125b-induced apoptosis resistance as well as TMZ resistance, indicating that both genes are relevant targets of miR-125b.
24884566 Single nucleotide polymorphisms in TNFAIP3 were associated with the risks of rheumatoid arthritis in northern Chinese Han population.
24871655 It is a proinflammatory mediator to cause vascular disease like atherosclerosis.
24852325 The results of this study suggest a protective and anti-inflammatory role of NR4A2 and TNFAIP3, both being under-regulated in monocytes and CD4 + T cells of MS patients.
24798189 a clear association between the polymorphisms of TNFAIP3 gene and Graves' disease,not Hashimoto's thyroiditis; TNFAIP3 gene is likely to be a genetic susceptibility factor to Graves' disease.
24747594 A20 overexpression may depress the inflammatory response induced by LPS in cultured RPMCs through negatively regulated the relevant function of adaptors in LPS signaling pathway.
24742347 HIV-1 and the viral protein Tat modulate the expression of tumor necrosis factor, alpha-induced protein 3 (TNFAIP3) in immature dendritic cells and monocyte-derived macrophages
24713261 identified A20 as a negative regulator for controlling acute myeloid leukemia-dendritic cells maturation and immunostimulatory potency
24611736 Authors characterized the features of A20 polymorphisms in T-ALL and found a low frequency A20 mutation.
24595242 Data indicate that tumor necrosis factor inducible protein A20-mediated inhibitor of apoptosis protein-2 (cIAP-2) is important in endothelial cell resistance to tumor necrosis factor alpha (TNF-alpha)-induced apoptosis.
24500711 A novel intronic enhancer for TNFAIP3 was synergistically induced by the glucocorticoid receptor and NF-kappaB.
24489933 A20 is a critical regulator for TLR1/2-induced pro-inflammatory responses.
24489017 The results suggest that TNFAIP3 gene polymorphisms are associated with differential susceptibility to systemic lupus erythematosus and rheumatoid arthritis in the Korean population.
24357803 Data demonstrate that the presence of A20 allows MSCs to differentiate into
24219294 Activation of IGF-1R can induce apoptosis in adipose-derived stem cells, whereas it can be prevented by the A20 and osteocalcin expression.
24159176 Somatic mutations of TNFAIP3 have been observed in the mucosa-associated lymphoid tissue lymphoma subtype frequently associated with pSS.
24099634 A20 bound p53 to form complexes in colon cancer tissue and colon polyps. Over expression of A20 suppresses P53 protein levels in HEK293 cells.
24091983 Report role of TNFAIP3 genetic variants in confering risk of systemic lupus erythematosus in Chinese population.
24055365 A20 zinc finger protein plays an anti-inflammatory role and protects against liver injury associated with trauma combined with lipopolysaccharide challenge.
24039598 these data reveal a novel mechanism of TNFAIP3 transcriptional regulation and establish the functional basis by which the TT>A risk variants attenuate A20 expression
24028082 Findings reveal the role of TAK1 in thermoresistance and show that the mediation is independent of NF-kappaB phosphorylation but is dependent on TNFAIP3 and IL-8 induction.
24023622 TNFAIP3 rs2230926G may be an important predictor of disease onset in males.
24008839 Here, we show that A20, a ubiquitin-editing enzyme, promotes efficient activation of the non-canonical pathway independent of its catalytic activity.
23901138 miR-29 has a role in protecting the tumor suppressor A20 mRNA from degradation by HuR in sarcoma
23884832 The gene expression profiling results showed that TNFAIP3, ATF3, PPARG are related to osteoarthritis.
23671587 A20 restricts beta-catenin signaling and prevents colon tumorigenesis.
23635951 Strong correlations have been observed between TNFSF4, TNFAIP3 and FAM167A-BLK polymorphisms with primary Sjogren's syndrome in Han Chinese.
23609450 inducible IRG1 promotes endotoxin tolerance by increasing A20 expression through ROS, indicating a new molecular mechanism regulating hypoinflammation of sepsis and endotoxin tolerance.
23555688 the association of a TNFAIP3 gene polymorphism with VKH disease in a Chinese Han population
23463983 Our results suggest that rs10499194, rs610604, rs7753873, rs5029928 and rs9494885 of TNFAIP3 are not associated with Fuchs' syndrome in a Chinese Han population.
23463012 The reversible form of A20 oxidation is a cysteine sulphenic acid intermediate, which is stabilised by the architecture of the catalytic centre.
23425151 rs675520 polymorphism associated with a 0.65-0.77 increased rate of joint destruction
23418597 Data indicate that A20 (TNFAIP3) deletion and/or dysfunctional expression are frequently associated with pyothorax-associated lymphoma (PAL), and A20 abnormalities may be related to the pathogenesis of PAL.
23327292 A20 deletion was observed in similar frequencies in GCB and non-GCB/ABC, and was not a poor prognostic factor in DLBCL.
23249958 Significant associations of four SNPs and haplotypes with antibody response to cholera vaccine in three genes, MARCO, TNFAIP3 and CXCL12.
23164641 A20 expression is reduced in CF and is proportional to FEV1
23161053 This study identified one strong risk SNP rs9494885 and two weak risk SNPs rs10499194 and rs7753873 of TNFAIP3 in Chinese Han Behcet disease (BD) patients.
23148088 Results suggest that A20 inactivation by the novel aberrant splicing may contribute to RA progression by inducing persistent NF-kappaB activation.
23114873 TNFIAP3 plays an important role in tethering endosomes to lysosomes.
23054742 These results suggest that the expression level of TNFAIP3 plays an important role in the pathology of psoriasis vulgaris and that the loss of upregulation of TNFAIP3 expression may contribute to the severity of psoriasis vulgaris.
23039325 Data indicate that the relative numbers of TNFAIP3/CD30 cells were distributed among three groups, corresponding to those having homozygous (11%), heterozygous (32%), and no (57%) deletions in TNFAIP3.
23032187 Analysis indicated that the binding of A20's zinc finger 7 domain to linear polyubiquitin contributes to the recruitment of A20 into a TNF receptor signalling complex containing Ikappa B kinase, which results in NF-kappa B suppression.
23032186 The data showed that A20 inhibits TNF- and linear ubiquitin chain assembly complex-induced NF-kappa B signalling by binding to linear polyubiquitin chains via its seventh zinc finger.
23018911 expression of A20 is significantly altered in cystic fibrosis, and important interactions with complex members and target proteins are lost, which may contribute to the state of chronic NF-kappaB-driven inflammation
23002441 Lack of both A20 and ubiquitin thiolesterase CYLD do not exacerbate the developmental defects and hyperresponsive activity of A20-deficient B cells.
22936803 A20 plays a critical role in processing of the absorbed SEB in nasal epithelial cells.
22925894 The results indicate that A20 plays an important role in the processing the endocytic allergen in HT-29 cells.
22924496 This meta-analysis confirms that the TNFAIP3 polymorphisms are associated with systemic lupus erythematosus susceptibility in different ethnic groups, namely in Asians and Europeans.
22898832 Down-regulation of A20 mRNA expression in peripheral blood mononuclear cells is correlated with the severity of systemic lupus erythematosus.
22843550 TNFAIP3 polymorphisms are associated with advanced colorectal cancer.
22634524 The essential components of the A20 ubiquitin-editing complex are present and mainly expressed in neurons. The A20 complex components are also differentially expressed throughout the human brain.
22623711 Expression of the autoimmunity associated TNFAIP3 is increased in rheumatoid arthritis but does not differ according to genotype at 6q23.
22586175 the present data do not support the initial findings that single-nucleotide polymorphisms of TRAF1-C5 and TNFAIP3-OLIG3 rare associated with the severity of joint destruction in RA.
22525270 Kaposi's sarcoma-associated herpesvirus (KSHV) K13/vFLIP (viral Flice-inhibitory protein) induces transcription of numerous genes through NF-kappaB activation, including pro-inflammatory cytokines
22488580 A variant of the TNFAIP3 locus is a susceptibility factor for the subset of systemic sclerosis with a polyautoimmune phenotype.
22461193 Low A20 expression is significantly associated with the pancreatic cancer behavior, but is not the sole determinant of pancreatic cancer progression.
22402800 TNFAIP3 polymorphisms are associated with rheumatoid arthritis susceptibility in different ethnic groups, namely, in Europeans for rs6920220 and in Asians for rs10499194
22397314 The incidence of TNFAIP3 mutations was 4.6% in Middle Eastern diffuse large B-cell lymphoma.
22285182 this study suggests that A20 protects against TRAIL-induced apoptosis through the regulation of RIP1 ubiquitination.
22207688 The cases with A20 mutation/deletion required significantly higher radiation dosages to achieve complete remission than those without these abnormalities.
22127930 SNPs in regulatory regions of TAGAP and an intronic SNP (TNFAIP3) are potential susceptibility loci in African Americans.
22099304 A noncatalytic mechanism of IKK inhibition by a potent anti-inflammatory protein A20 has been demonstrated.
22093807 recombinant transgene facilitates the transcription of pro-inflammatory cytokines in fibroblast-like synoviocytes in rheumatoid arthritis
22087647 Data indicate that TNFAIP3, ETS1 and TNIP1 are probably common susceptibility genes for systemic lupus erythematosus (SLE) in Chinese populations, and they may contribute to the pathogenesis of multiple SLE subphenotypes.
22031828 Studies support the role of TNFAIP3 in promoting intestinal epithelial barrier integrity and demonstrate its novel ability to maintain intestinal homeostasis through tight junction protein regulation.
22019834 DCs need A20 to preserve immune quiescence and suggest that A20-dependent DC functions may underlie IBD and IBD-associated arthritides.
21968712 TGF-beta1 promotes overexpression of A20 through tyrosine phosphatase activity that ensures transient activation of inflammatory signaling pathways in macrophages in active L. donovani infection.
21964925 although A20 is known as a signaling fine-tuner to prevent excess TLR signaling, it paradoxically downregulates the fine-tuning effect of NDP52 on TLR signaling.
21885437 ABIN1 requires its ubiquitin binding domain and cooperates with TAX1BP1 and A20 to restrict antiviral signaling.
21795344 In particular, two negative regulators of NF-kappaB, IkappaBa and A20, were upregulated during poliovirus infection.
21787353 Genetic relationships between A20/TNFAIP3, chronic inflammation and autoimmune disease
21763284 miR-29c may play an important role as a tumor suppressive microRNA in the development and progression of HBV-related hepatocellular carcinoma by targeting TNFAIP3.
21740805 The findings indicate that the SNP (rs5029939) in the TNFAIP3 gene may serve as a novel protective genetic marker for the development of LVH in patients with hypertension.
21625233 Loss of TNFAIP3 is associated with Sezary syndrome.
21604024 A failure of TNFAIP3 negative regulation maintains sustained NF-kappaB activation in Sjogren's syndrome
21566404 It regulates NF-kappaB pathway and its inactivation effects the pathophysiology of B cell lymphoma. (review)
21531730 K13 is a key determinant of A20 expression in KSHV-infected cells, and A20 is a key negative regulator of K13-induced NF-kappaB activity
21437236 The systems biology modulated by A20 following extended liver resection in mice.
21406721 A20 inactivation was observed in both EBV(+) and EBV(-) AIDS-related lymphoma.
21336280 These results establish this TT>A variant as the most likely functional polymorphism responsible for the association between TNFAIP3 and SLE.
21326317 32 polymorphisms were identified in the sequencing experiments, including 16 novel and 11 coding variants
21266526 A20, ABIN-1/2, and CARD11 mutations have prognostic value in gastrointestinal diffuse large B-cell lymphoma
21220427 LPS-induced activation of IRAK4 and TAK1, K63-linked polyubiquitination of IRAK1 and TRAF6, and disrupted IRAK1-TRAF6 and IRAK1-IKKgamma assembly associated with increased A20 expression
21208380 This meta-analysis demonstrates a significant association between BANK1 and TNFAIP3 gene polymorphism and systemic lupus erythematosus in multiple ethnic populations.
21127049 A20 appeared to be a late-expressed gene in LPS-treated cultures and was associated with TRAF6 degradation and NF-kappaB inhibition; A20 appeared important in the control of bone resorption
21111841 Here, we review recent advances illustrating the role of A20 as an essential negative regulator of inflammatory and antiviral signaling.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20921970 SNP within the OLIG3/TNFAIP3 locus (rs6920220) was associated with being less likely to maintain MTX monotherapy
20921970 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20852893 we find replicating association of rare variation at the TNFAIP# locus with RA susceptibility
20852893 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20849588 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20822710 This is the first observation of TNFAIP3 protein expression in rheumatoid arthritis and osteoarthritis synovium.
20804738 A20 is cleaved by MALT1 with the realease of the hA20p50 and hA20p37 fragments.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20669229 results indicate that malignant development in CLL differs from most of other B-cell malignancies, which show frequent inactivation of A20
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20617138 A case-control association study was performed on the TNFAIP3 SNPs rs13192841, rs2230926, and rs6922466 in 318 Japanese SLE patients and 444 healthy controls.
20617138 Observational study of gene-disease association. (HuGE Navigator)
20585109 A20 improves cardiac functions and inhibits cardiac hypertrophy, inflammation, apoptosis, and fibrosis by blocking transforming growth factor-beta-activated kinase 1-dependent signaling.
20533286 Mutation analysis of the TNFAIP3 (A20) tumor suppressor gene in chronic lymphocytic leukemia
20533286 Observational study of gene-disease association. (HuGE Navigator)
20511617 Results provide evidence for a strong association between TNFAIP3 and susceptibility to systemic sclerosis, indicating that this gene may be added to the list of genes associated with systemic sclerosis
20511617 Observational study of gene-disease association. (HuGE Navigator)
20483768 This is the first report of an association between TNFAIP3 polymorphisms and autoimmunity in African-Americans.
20483768 Observational study of gene-disease association. (HuGE Navigator)
20448643 A20 protein has an essential function in the NF-kappaB-mediated suppression of JNK activation and apoptosis on TNFR1 ligation.
20444755 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20439292 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20430393 A20 downregulates adhesion markers, chemokine production, and adventitial angiogenesis, all of which are required for macrophage trafficking to sites of vascular injury
20392859 A20 negatively regulates LMP1-stimulated IRF7 ubiquitination and activity in EBV latency.
20353580 Observational study of gene-disease association. (HuGE Navigator)
20304918 results demonstrate TBK1-IKKi to be novel substrates for A20 and further identify a novel mechanism whereby A20 and TAX1BP1 restrict antiviral signaling by disrupting a TRAF3-TBK1-IKKi signaling complex
20233754 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20231195 Our results show no involvement of this 6q23/TNFAIP3 gene region SNP in the susceptibility to or clinical expression of giant cell arteritis.
20231195 Observational study of gene-disease association. (HuGE Navigator)
20186265 The decreased survival of GSCs upon A20 knockdown contributed to the reduced ability of these cells to self-renew in primary and secondary neurosphere formation assays.
20176734 Observational study of gene-disease association. (HuGE Navigator)
20112363 TNFAIP3, similar to STAT4 and IRF5, may be a common genetic risk factor for systemic lupus erythematosus and rheumatoid arthritis that is shared between the Caucasian and Japanese populations
20112363 Observational study of gene-disease association. (HuGE Navigator)
20049410 Observational study of gene-disease association. (HuGE Navigator)
20032510 Ca(2+) influx via TRPC1 channels plays a critical role in the mechanism of cell survival signaling through NF-kappaB/RelA-dependent A20 expression to prevent thrombin-induced apoptosis in endothelial cells.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912257 Data show that the expression of A20 was increased rapidly and peaked at 1 h after flagellin stimulation.
19907439 Loss of A20 expression by promoter methylation, deletion and inactivating mutation is associated with MALT lymphoma.
19902201 Studies show that a new genetic variant (rs582757) in TNFAIP3 gene associated with the prevalence of RHD in Chinese Han population.
19902201 Observational study of gene-disease association. (HuGE Navigator)
19879194 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19851077 Endothelial progenitor cells can be genetically modified to overexpress A20 in a stable fashion. These cells become less sensitive to inflammatory stimuli.
19838193 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19774492 Single nucleotide polymorphism rs2230926 in the TNFAIP3 might be a common genetic factor for systemic lupus erythematosus within different populations in terms of Chinese Han and European population.
19774492 Observational study of gene-disease association. (HuGE Navigator)
19648161 A heterozygous, possibly subclonal, two base-pair insertion in TNFAIP3 is found in a case of nodular lymphocyte-predominant Hodgkin's lymphoma (NLPHL) that suggests a different mechanism of NF-kappaB activity in NLPHL compared to classical Hodgkin's lymphoma.
19643665 These findings further illustrate the importance of A20 in the resolution of inflammation and the prevention of human disease.
19617629 adiponectin augmented the expression of A20, suppressor of cytokine signaling (SOCS) 3, B-cell CLL/lymphoma (BCL) 3, TNF receptor-associated factor (TRAF) 1, and TNFAIP3-interacting protein (TNIP) 3.
19608751 Down-regulated TNFAIP3 is associated with non-Hodgkin lymphomas.
19565500 There are associations between juvenile idiopathic arthritis and variants in the TNFAIP3, STAT4, and C12orf30 regions that have previously shown associations with other autoimmune diseases, including rheumatoid arthritis and systemic lupus erythematosus.
19565500 Observational study of gene-disease association. (HuGE Navigator)
19494296 A20 functions as a Malt1 deubiquitinating enzyme and proteasomal degradation and de novo synthesis of A20 contributes to balance T cell receptor/CD28-induced IKK/NF-kappaB signaling
19492975 A20 was overexpressed both in human glioma tissues and cell lines, and inhibiting A20 expression greatly slowed tumor cell growth
19453261 Observational study of gene-disease association. (HuGE Navigator)
19412163 show, using a genome-wide analysis of genetic lesions in 238 B-cell lymphomas, that A20 is a common genetic target in B-lineage lymphomas
19387456 Study in systemic lupus erythematosus patients observed that heterozygous carriers of the TNFAIP3 risk allele at rs5029939 have a twofold increased risk of developing renal or hematologic manifestations compared to homozygous non-risk subjects.
19387456 Meta-analysis of gene-disease association. (HuGE Navigator)
19380639 Frequency of A20 mutations in Epstein-Barr virus negative than positive Hodgkin lymphoma suggest complementing functions in virus infection in lymphoma pathogenesis.
19380636 Somatic mutations in TNFAIP3, the gene encoding the NF-kappaB inhibitor A20, are found in Hodgkin lymphomas and primary mediastinal lymphomas
19366996 Observational study of gene-disease association. (HuGE Navigator)
19344623 Polymorphisms in TNFAIP3 gene are associated with chronic rhinosinusitis.
19344623 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19292917 several rheumatoid arthritis genetic factors exist in the 6q23 region, including polymorphisms in the TNFAIP3 gene
19292917 Observational study of gene-disease association. (HuGE Navigator)
19262574 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19258598 A20 inactivation by either somatic mutation and/or deletion represents a common genetic aberration across all MZL subtypes, which may contribute to lymphomagenesis by inducing constitutive NF-kappaB activation.
19240061 Both TNFAIP3 (A20, at the protein level) and REL are key mediators in the nuclear factor kappa B (NF-kappaB) inflammatory signalling pathway.
19169254 Expanded catalog of genetic loci implicated in psoriasis susceptibility.
19165919 We show that three independent SNPs in the TNFAIP3 region (rs13192841, rs2230926 and rs6922466) are associated with systemic lupus erythematosus (SLE) among individuals of European ancestry
19165919 Observational study of gene-disease association. (HuGE Navigator)
19165918 Genome-wide association study of gene-disease association. (HuGE Navigator)
19165918 These results establish that variants near TNFAIP3 contribute to differential risk of SLE and RA.
19152111 TNFalpha triggers both caspase 8-dependent and -independent cell death pathways in macrophages and identify a novel mechanism by which A20 protects these cells against both pathways.
19131965 RNF11, together with TAX1BP1 and Itch, is an essential component of an A20 ubiquitin-editing protein complex that ensures transient activation of inflammatory signalling pathways.
19124729 Dendritic cells downregulated by A20 show higher activation of transcription factors NF-kappaB and activator protein-1, which results in increased and sustained production of interleukin (IL)-6, IL-10, and IL-12p70.
19110536 evidence that the RA/SLE locus 6q23/TNFAIP3 is a newly identified T1D locus.
19110536 Observational study of gene-disease association. (HuGE Navigator)
18814951 five genes (TNFSF10/TRAIL, IL1RN, IFI27, GZMB, and CCR5) were upregulated and three genes (CLK1, TNFAIP3 and BTG1) were downregulated in at least three out of four subpopulations during acute GVHD.
18813897 Pre-treatment of human umbilical vein endothelial cells with an adenovirus containing A20 suppressed activation of NF-kappaB and induction of pro-inflammatory molecules by hypoxia/re-oxygenation.
18794853 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
18349075 results further define the molecular mechanisms that control activation of NF-kappaB and reveal a function for A20 in the regulation of CARMA and BCL10 activity in lymphoid and non-lymphoid cells
18164316 Molecular basis for the unique deubiquitinating activity of the NF-kapppaB inhibitor A20 is reported.
17982456 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17962196 These findings reveal a dynamic regulation of DSIF involving either E-box or NF-kappaB depending on the physiological circumstances.
17961127 analysis of the crystal structure of the N-terminal OTU (ovarian tumour) deubiquitinase domain of A20
17953374 A20 and HO-1 may play protective role in acute graft rejection.
17886247 May act as a tumor suppressor gene in ocular adnexal marginal zone B cell lymphoma; loss of this gene may play an important role in lymphomagenesis.
17297453 A20 is a new 17beta-estradiol-regulated gene.
17259397 Observational study of gene-disease association. (HuGE Navigator)
17259397 These findings point to variability in the A20/TNFAIP3 gene as a modulator of CAD risk in type 2 diabetes. This effect is mediated by allelic differences in A20 expression.
16936197 Using oligonucleotide microarrays and real-time PCR, we identified TNFAIP3/A20 as the most highly regulated antiapoptotic gene expressed in cytokine-stimulated human and mouse islets.
16824518 A new role for A20 in regulating neovascularisation. We used RNA interference to inhibit A20 expression in primary human umbilical vein endothelial cells (HUVECs)and investigated the effect on tubule formation in two in vitro angiogenesis assays
16816117 A20 prevents neointimal hyperplasia through combined anti-inflammatory and antiproliferative functions in medial smooth muscle cells.
16684768 ABIN-1 physically links A20 to NEMO/IKKgamma and facilitates A20-mediated de-ubiquitination of NEMO/IKKgamma, thus resulting in inhibition of NF-kappaB
16474993 Results suggest that A20 can effectively protect neurons from postischemic apoptosis and may function partly on death receptor caspase pathway.
16306043 the virus-inducible, NF-kappaB-dependent activation of A20 functions as a negative regulator of RIG-I-mediated induction of the antiviral state
16164629 A1 and A20 are both required for optimal protection from apoptosis (A1) and inflammation (A20) in conditions leading to renal damage
15862966 A20 may be involved in the regulation of cell proliferation by tumor necrosis factor, Vitamin D, and androgen in prostate cancer.
15661910 A20 is a candidate negative regulator of the signaling cascade to interferon regulatory factor-3 activation in the innate antiviral response.
15258597 definition of a novel ubiquitin ligase domain and identification of two sequential mechanisms by which A20 downregulates NF-kappaB signalling
15251990 A20 also protects from Fas/CD95 and significantly blunts natural killer cell-mediated endothelial cell apoptosis by inhibiting caspase 8 activation
15142865 Our results suggest that A20 may function as a negative regulator of TLR-mediated inflammatory responses in the airway, thereby protecting the host against harmful overresponses to pathogens.
14754897 redundant and distinct roles in regulating NFkappaB activation and apoptosis
12794157 In vitro, recombinant A20 inhibits NF-kappaB activation in mouse islets and protects from cytokine- and death receptor-mediated apoptosis; in vivo, A20 preserves mouse islet cell mass and function in diabetic mice in early post-transplantation period.
12167698 The zinc finger protein A20 is an NF-kappaB-inducible gene that can protect the IKKgamma-deficient cells from TNF-induced apoptosis by disrupting the recruitment of the death domain signaling molecules TRADD and RIP to the receptor signaling complex.

AA Sequence

MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALID      1 - 70
RNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKF     71 - 140
RWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVI    141 - 210
SDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDR    211 - 280
GRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQ    281 - 350
HEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK    351 - 420
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQ    421 - 490
HNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCH    491 - 560
QRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIE    561 - 630
YRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQ    631 - 700
RRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHF    701 - 770
GNAKCNGYCNECFQFKQMYG                                                      771 - 790
//

Text Mined References (286)

PMID Year Title
27175295 2016 Novel heterozygous C243Y A20/TNFAIP3 gene mutation is responsible for chronic inflammation in autosomal-dominant Behçet's disease.
26802121 2016 Recruitment of A20 by the C-terminal domain of NEMO suppresses NF-?B activation and autoinflammatory disease.
26758190 2016 MiR-125a regulates chemo-sensitivity to gemcitabine in human pancreatic cancer cells through targeting A20.
26738398 2015 TNFAIP3 and TNIP1 polymorphisms confer psoriasis risk in South Indian Tamils.
26724675 2016 Downstream activation of NF-?B in the EDA-A1/EDAR signalling in Sjögren's syndrome and its regulation by the ubiquitin-editing enzyme A20.
26716984 2015 A20 Mutation Is Not a Prognostic Marker for Activated B-Cell-Like Diffuse Large B-Cell Lymphoma.
26679293 2016 Low Protein A20 in Minor Salivary Glands is Associated with Lymphoma in Primary Sjögren's Syndrome.
26652732 2016 A20 Inhibits ?-Cell Apoptosis by Multiple Mechanisms and Predicts Residual ?-Cell Function in Type 1 Diabetes.
26642243 2016 Loss-of-function mutations in TNFAIP3 leading to A20 haploinsufficiency cause an early-onset autoinflammatory disease.
26598072 2015 Evaluation of the germline single nucleotide polymorphism rs583522 in the TNFAIP3 gene as a prognostic marker in esophageal cancer.
26561336 2015 Inhibition of A20 expression in tumor microenvironment exerts anti-tumor effect through inducing myeloid-derived suppressor cells apoptosis.
26485275 2015 The Prognostic Role of SOCS3 and A20 in Human Cholangiocarcinoma.
26474180 2016 Identification of an Association of TNFAIP3 Polymorphisms With Matrix Metalloproteinase Expression in Fibroblasts in an Integrative Study of Systemic Sclerosis-Associated Genetic and Environmental Factors.
26437781 2016 A20 targets caspase-8 and FADD to protect HTLV-I-infected cells.
26426612 2015 Upregulated Expression of A20 on Monocytes is Associated With Increased Severity of Acute-on-Chronic Hepatitis B Liver Failure: A Case-Control Study.
26382585 2015 Up-regulation of A20/ABIN1 contributes to inefficient M1 macrophage polarization during Hepatitis C virus infection.
26367773 2015 Uncovering Direct Targets of MiR-19a Involved in Lung Cancer Progression.
26339029 2015 Farm dust and endotoxin protect against allergy through A20 induction in lung epithelial cells.
26338037 2016 Germline variation of TNFAIP3 in primary Sjögren's syndrome-associated lymphoma.
26199174 2016 Recurrent alterations of TNFAIP3 (A20) in T-cell large granular lymphocytic leukemia.
26159495 2015 Up-regulated A20 promotes proliferation, regulates cell cycle progression and induces chemotherapy resistance of acute lymphoblastic leukemia cells.
26143186 2015 Characteristics of A20 gene polymorphisms and clinical significance in patients with rheumatoid arthritis.
26107748 2015 Aberrant Low Expression of A20 in Tumor Necrosis Factor-?-stimulated SLE Monocytes Mediates Sustained NF-?B Inflammatory Response.
26005883 Lack of association of TNFAIP3 and JAK1 with Behçet's disease in the European population.
25993287 2015 Hepatitis B Virus X Protein Sensitizes TRAIL-Induced Hepatocyte Apoptosis by Inhibiting the E3 Ubiquitin Ligase A20.
25956706 2015 Correlation of Biomarker Expression in Colonic Mucosa with Disease Phenotype in Crohn's Disease and Ulcerative Colitis.
25911380 2015 The seventh zinc finger motif of A20 is required for the suppression of TNF-?-induced apoptosis.
25890346 2015 Association between TNFAIP3 nonsynonymous single-nucleotide polymorphism rs2230926 and chronic hepatitis B virus infection in a Chinese Han population.
25856582 2015 Frequent down regulation of the tumor suppressor gene a20 in multiple myeloma.
25806576 2016 The polymorphisms of tumor necrosis factor-induced protein 3 gene may contribute to the susceptibility of chronic primary immune thrombocytopenia in Chinese population.
25684197 2015 Association of TNFAIP3 and TNFRSF1A variation with multiple sclerosis in a German case-control cohort.
25683052 2015 MicroRNA let-7 modulates the immune response to Mycobacterium tuberculosis infection via control of A20, an inhibitor of the NF-?B pathway.
25674272 2014 TNFAIP3 rs2230926 polymorphisms in rheumatoid arthritis of southern Chinese Han population: a case-control study.
25631139 2015 Upregulation of tumor necrosis factor alpha-induced protein 3 interacting protein 1 mRNA in psoriasis vulgaris.
25521225 2015 Meta-analysis of the TNFAIP3 region in psoriasis reveals a risk haplotype that is distinct from other autoimmune diseases.
25496073 2015 The TNFAIP3 polymorphism rs610604 both associates with the risk of psoriasis vulgaris and affects the clinical severity.
25451900 2014 Decreased A20 mRNA and protein expression in peripheral blood mononuclear cells in patients with type 2 diabetes and latent autoimmune diabetes in adults.
25416956 2014 A proteome-scale map of the human interactome network.
25406098 2015 TNFAIP3 and IL12B gene polymorphisms associated with psoriasis vulgaris in an Egyptian cohort.
25384343 2014 Characteristics of CARMA1-BCL10-MALT1-A20-NF-?B expression in T cell-acute lymphocytic leukemia.
25354935 2014 An A/C germline single-nucleotide polymorphism in the TNFAIP3 gene is associated with advanced disease stage and survival in only surgically treated esophageal cancer.
25337792 2014 Genetic association study of TNFAIP3, IFIH1, IRF5 polymorphisms with polymyositis/dermatomyositis in Chinese Han population.
25302371 2014 Single nucleotide polymorphisms at the TNFAIP3/A20 locus and susceptibility/resistance to inflammatory and autoimmune diseases.
25264125 2014 Investigating the genetic association of HCP5, SPATA2, TNIP1, TNFAIP3 and COG6 with psoriasis in Chinese population.
25230785 2014 Zinc finger A20 and NF-?B correlate with high-risk human papillomavirus of squamous cell carcinoma patients.
25217635 2014 A20 regulates atherogenic interferon (IFN)-? signaling in vascular cells by modulating basal IFN? levels.
25190567 2015 Adiponectin induces A20 expression in adipose tissue to confer metabolic benefit.
25050625 2014 Functional effect of polymorphisms in the promoter of TNFAIP3 (A20) in acute pancreatitis in the Han Chinese population.
25034154 2014 Clinical perspectives on lupus genetics: advances and opportunities.
25024217 2014 The tumor necrosis factor alpha-induced protein 3 (TNFAIP3, A20) imposes a brake on antitumor activity of CD8 T cells.
24971370 2014 Alternative expression pattern of MALT1-A20-NF-?B in patients with rheumatoid arthritis.
24965710 2014 Role of A20 in interferon-?-mediated functional restoration of myeloid dendritic cells in patients with chronic hepatitis C.
24953694 2014 Induction of the cellular miR-29c by influenza virus inhibits the innate immune response through protection of A20 mRNA.
24901050 2014 miR-125b controls apoptosis and temozolomide resistance by targeting TNFAIP3 and NKIRAS2 in glioblastomas.
24884566 2014 Single nucleotide polymorphisms in TNFAIP3 were associated with the risks of rheumatoid arthritis in northern Chinese Han population.
24871655 2014 Magnolol reduced TNF-?-induced vascular cell adhesion molecule-1 expression in endothelial cells via JNK/p38 and NF-?B signaling pathways.
24852325 2014 Monocytes and CD4+ T cells contribution to the under-expression of NR4A2 and TNFAIP3 genes in patients with multiple sclerosis.
24798189 2014 Polymorphisms of the TNFAIP3 region and Graves' disease.
24747594 2014 A20 overexpression inhibits lipopolysaccharide-induced NF-?B activation, TRAF6 and CD40 expression in rat peritoneal mesothelial cells.
24713261 2014 Attenuated A20 expression of acute myeloid leukemia-derived dendritic cells increased the anti-leukemia immune response of autologous cytolytic T cells.
24611736 2014 Characteristics of A20 gene polymorphisms in T-cell acute lymphocytic leukemia.
24595242 2014 Role of A20 in cIAP-2 protection against tumor necrosis factor ? (TNF-?)-mediated apoptosis in endothelial cells.
24500711 2014 Context-dependent cooperation between nuclear factor ?B (NF-?B) and the glucocorticoid receptor at a TNFAIP3 intronic enhancer: a mechanism to maintain negative feedback control of inflammation.
24489933 2014 A20 is critical for the induction of Pam3CSK4-tolerance in monocytic THP-1 cells.
24489017 2014 TNFAIP3 gene polymorphisms associated with differential susceptibility to rheumatoid arthritis and systemic lupus erythematosus in the Korean population.
24449572 2014 Novel rheumatoid arthritis susceptibility locus at 22q12 identified in an extended UK genome-wide association study.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24357803 2013 Identification of the NF-?B inhibitor A20 as a key regulator for human adipogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24219294 2013 A combination of insulin and ubiquitin A20 promotes osteocalcin expression in adipose-derived stem cells.
24159176 2013 Germline and somatic genetic variations of TNFAIP3 in lymphoma complicating primary Sjogren's syndrome.
24099634 2013 Ubiquitin ligase A20 regulates p53 protein in human colon epithelial cells.
24097066 2013 A genome-wide association study in Han Chinese identifies a susceptibility locus for primary Sjögren's syndrome at 7q11.23.
24091983 2014 Variants in TNFSF4, TNFAIP3, TNIP1, BLK, SLC15A4 and UBE2L3 interact to confer risk of systemic lupus erythematosus in Chinese population.
24055365 2013 An anti-inflammatory role of A20 zinc finger protein during trauma combined with endotoxin challenge.
24039598 2013 An enhancer element harboring variants associated with systemic lupus erythematosus engages the TNFAIP3 promoter to influence A20 expression.
24028082 2013 TAK1 promotes cell survival by TNFAIP3 and IL-8 dependent and NF-?B independent pathway in HeLa cells exposed to heat stress.
24023622 2013 Analysis of gender differences in genetic risk: association of TNFAIP3 polymorphism with male childhood-onset systemic lupus erythematosus in the Japanese population.
24008839 2013 Involvement of A20 in the molecular switch that activates the non-canonical NF-?B pathway.
23901138 2013 miR-29 acts as a decoy in sarcomas to protect the tumor suppressor A20 mRNA from degradation by HuR.
23884832 2013 Expression profiling based on graph-clustering approach to determine osteoarthritis related pathway.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23671587 2013 A20 restricts wnt signaling in intestinal epithelial cells and suppresses colon carcinogenesis.
23635951 2013 Association studies of TNFSF4, TNFAIP3 and FAM167A-BLK polymorphisms with primary Sjogren's syndrome in Han Chinese.
23609450 2013 Immune responsive gene 1 (IRG1) promotes endotoxin tolerance by increasing A20 expression in macrophages through reactive oxygen species.
23555688 2013 TNFAIP3 gene polymorphisms in a Chinese Han population with Vogt-Koyanagi-Harada syndrome.
23463983 2014 Polymorphisms of TNFAIP3 gene in a Chinese Han population with fuchs heterochromic iridocyclitis.
23463012 2013 Regulation of A20 and other OTU deubiquitinases by reversible oxidation.
23425151 2013 Comparison of methodologies for analysing the progression of joint destruction in rheumatoid arthritis.
23418597 2013 A20 (TNFAIP3) deletion in Epstein-Barr virus-associated lymphoproliferative disorders/lymphomas.
23327292 2013 Clinicopathologic implication of A20/TNFAIP3 deletion in diffuse large B-cell lymphoma: an analysis according to immunohistochemical subgroups and rituximab treatment.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23249958 2013 Genomic correlates of variability in immune response to an oral cholera vaccine.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23164641 2013 Expression of the inflammatory regulator A20 correlates with lung function in patients with cystic fibrosis.
23161053 2013 TNFAIP3 gene polymorphisms confer risk for Behcet's disease in a Chinese Han population.
23148088 2013 Intron-derived aberrant splicing of A20 transcript in rheumatoid arthritis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23114873 2013 Ubiquitin E3 ligase TNFIAP3 mediates endosome/lysosome fusion in nasal epithelial cells.
23054742 2012 Expression of tumor necrosis factor alpha-induced protein 3 mRNA in peripheral blood mononuclear cells negatively correlates with disease severity in psoriasis vulgaris.
23039325 2012 Deletion of the TNFAIP3/A20 gene detected by FICTION analysis in classical Hodgkin lymphoma.
23032187 2012 Specific recognition of linear polyubiquitin by A20 zinc finger 7 is involved in NF-?B regulation.
23032186 2012 A20 inhibits LUBAC-mediated NF-?B activation by binding linear polyubiquitin chains via its zinc finger 7.
23018911 2013 Expression of the nuclear factor-?B inhibitor A20 is altered in the cystic fibrosis epithelium.
23002441 2012 A20 and CYLD do not share significant overlapping functions during B cell development and activation.
22936803 2012 Ubiquitin E3 ligase A20 facilitates processing microbial product in nasal epithelial cells.
22925894 2012 Probiotics promote endocytic allergen degradation in gut epithelial cells.
22924496 2012 Associations between TNFAIP3 gene polymorphisms and systemic lupus erythematosus: a meta-analysis.
22898832 2012 Down-regulation of A20 mRNA expression in peripheral blood mononuclear cells from patients with systemic lupus erythematosus.
22843550 2012 Genetic variation and alterations of genes involved in NF?B/TNFAIP3- and NLRP3-inflammasome signaling affect susceptibility and outcome of colorectal cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22634524 2012 Comparative distribution of protein components of the A20 ubiquitin-editing complex in normal human brain.
22623711 2012 Expression of the autoimmunity associated TNFAIP3 is increased in rheumatoid arthritis but does not differ according to genotype at 6q23.
22586175 2012 Studying associations between variants in TRAF1-C5 and TNFAIP3-OLIG3 and the progression of joint destruction in rheumatoid arthritis in multiple cohorts.
22525270 2013 A20/TNFAIP3 inhibits NF-?B activation induced by the Kaposi's sarcoma-associated herpesvirus vFLIP oncoprotein.
22488580 2012 Brief report: candidate gene study in systemic sclerosis identifies a rare and functional variant of the TNFAIP3 locus as a risk factor for polyautoimmunity.
22461193 2012 Expression of A20 is reduced in pancreatic cancer tissues.
22402800 2012 Associations between TNFAIP3 gene polymorphisms and rheumatoid arthritis: a meta-analysis.
22397314 2012 Role of nuclear factor-?B regulators TNFAIP3 and CARD11 in Middle Eastern diffuse large B-cell lymphoma.
22285182 2012 Targeting A20 enhances TRAIL-induced apoptosis in hepatocellular carcinoma cells.
22207688 2012 A20 inactivation in ocular adnexal MALT lymphoma.
22127930 2012 Association of single-nucleotide polymorphisms in CCR6, TAGAP, and TNFAIP3 with rheumatoid arthritis in African Americans.
22099304 2011 Direct, noncatalytic mechanism of IKK inhibition by A20.
22093807 2012 A pro-inflammatory role for A20 and ABIN family proteins in human fibroblast-like synoviocytes in rheumatoid arthritis.
22087647 2011 Replicated associations of TNFAIP3, TNIP1 and ETS1 with systemic lupus erythematosus in a southwestern Chinese population.
22031828 2011 TNFAIP3 maintains intestinal barrier function and supports epithelial cell tight junctions.
22019834 2011 Expression of A20 by dendritic cells preserves immune homeostasis and prevents colitis and spondyloarthritis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21968712 2012 TGF-?1 re-programs TLR4 signaling in L. donovani infection: enhancement of SHP-1 and ubiquitin-editing enzyme A20.
21964925 2012 Regulation of Toll-like receptor signaling by NDP52-mediated selective autophagy is normally inactivated by A20.
21885437 2011 ABIN1 protein cooperates with TAX1BP1 and A20 proteins to inhibit antiviral signaling.
21795344 2011 Escape from transcriptional shutoff during poliovirus infection: NF-?B-responsive genes I?Ba and A20.
21787353 2011 Genetic relationships between A20/TNFAIP3, chronic inflammation and autoimmune disease.
21763284 2011 miR-29c targets TNFAIP3, inhibits cell proliferation and induces apoptosis in hepatitis B virus-related hepatocellular carcinoma.
21740805 2011 Variants of tumor necrosis factor-induced protein 3 gene are associated with left ventricular hypertrophy in hypertensive patients.
21625233 2011 Tumor suppressor TNFAIP3 (A20) is frequently deleted in Sézary syndrome.
21604024 2011 A failure of TNFAIP3 negative regulation maintains sustained NF-?B activation in Sjögren's syndrome.
21566404 2011 [Significance of A20 in B-cell lymphomas].
21531730 2011 A20 is induced by Kaposi sarcoma-associated herpesvirus-encoded viral FLICE inhibitory protein (vFLIP) K13 and blocks K13-induced nuclear factor-kappaB in a negative feedback manner.
21437236 2011 A20 modulates lipid metabolism and energy production to promote liver regeneration.
21406721 2011 A20 (TNFAIP3) genetic alterations in EBV-associated AIDS-related lymphoma.
21336280 2011 Association of a functional variant downstream of TNFAIP3 with systemic lupus erythematosus.
21326317 2011 Sequencing of TNFAIP3 and association of variants with multiple autoimmune diseases.
21266526 2011 A20, ABIN-1/2, and CARD11 mutations and their prognostic value in gastrointestinal diffuse large B-cell lymphoma.
21220427 2011 Endotoxin tolerance impairs IL-1 receptor-associated kinase (IRAK) 4 and TGF-beta-activated kinase 1 activation, K63-linked polyubiquitination and assembly of IRAK1, TNF receptor-associated factor 6, and IkappaB kinase gamma and increases A20 expression.
21208380 2011 The association between BANK1 and TNFAIP3 gene polymorphisms and systemic lupus erythematosus: a meta-analysis.
21127049 2011 Role of the A20-TRAF6 axis in lipopolysaccharide-mediated osteoclastogenesis.
21111841 2011 Regulation of inflammatory and antiviral signaling by A20.
21095585 2010 Ubiquitin binding to A20 ZnF4 is required for modulation of NF-?B signaling.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20921970 2012 A genetic marker at the OLIG3/TNFAIP3 locus associates with methotrexate continuation in early inflammatory polyarthritis: results from the Norfolk Arthritis Register.
20852893 2010 Rare variation at the TNFAIP3 locus and susceptibility to rheumatoid arthritis.
20849588 2010 Association of TNFAIP3 interacting protein 1, TNIP1 with systemic lupus erythematosus in a Japanese population: a case-control association study.
20822710 Functional evaluation of TNFAIP3 (A20) in rheumatoid arthritis.
20804738 2010 Cleavage by MALT1 induces cytosolic release of A20.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20669229 2011 Sustained NF-kappaB activity in chronic lymphocytic leukemia is independent of genetic and epigenetic alterations in the TNFAIP3 (A20) locus.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20617138 2010 Association of TNFAIP3 polymorphism with susceptibility to systemic lupus erythematosus in a Japanese population.
20585109 2010 Tumor suppressor A20 protects against cardiac hypertrophy and fibrosis by blocking transforming growth factor-beta-activated kinase 1-dependent signaling.
20533286 2011 Mutation analysis of the TNFAIP3 (A20) tumor suppressor gene in CLL.
20511617 2010 Association of the TNFAIP3 rs5029939 variant with systemic sclerosis in the European Caucasian population.
20483768 2010 African-derived genetic polymorphisms in TNFAIP3 mediate risk for autoimmunity.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20453841 2010 A regulatory variant in CCR6 is associated with rheumatoid arthritis susceptibility.
20448643 2010 Novel anti-apoptotic mechanism of A20 through targeting ASK1 to suppress TNF-induced JNK activation.
20444755 2010 Investigation of rheumatoid arthritis susceptibility genes identifies association of AFF3 and CD226 variants with response to anti-tumour necrosis factor treatment.
20439292 2010 Genetic variants in the prediction of rheumatoid arthritis.
20430393 2010 A20 inhibits post-angioplasty restenosis by blocking macrophage trafficking and decreasing adventitial neovascularization.
20392859 2010 The A20 deubiquitinase activity negatively regulates LMP1 activation of IRF7.
20353580 2010 Evaluation of the rheumatoid arthritis susceptibility loci HLA-DRB1, PTPN22, OLIG3/TNFAIP3, STAT4 and TRAF1/C5 in an inception cohort.
20304918 2010 TAX1BP1 and A20 inhibit antiviral signaling by targeting TBK1-IKKi kinases.
20233754 2010 Cumulative association of 22 genetic variants with seropositive rheumatoid arthritis risk.
20231195 2010 Lack of association between the rs6920220 (G/A) polymorphism of the 6q23 region and biopsy-proven giant cell arteritis.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20186265 2010 Targeting A20 decreases glioma stem cell survival and tumor growth.
20176734 2010 Comparative genetic analysis of inflammatory bowel disease and type 1 diabetes implicates multiple loci with opposite effects.
20112363 2010 The association of a nonsynonymous single-nucleotide polymorphism in TNFAIP3 with systemic lupus erythematosus and rheumatoid arthritis in the Japanese population.
20049410 2010 A functionally relevant IRF5 haplotype is associated with reduced risk to Wegener's granulomatosis.
20032510 2010 Ca2+ influx via TRPC channels induces NF-kappaB-dependent A20 expression to prevent thrombin-induced apoptosis in endothelial cells.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19912257 2010 A20 is an early responding negative regulator of Toll-like receptor 5 signalling in intestinal epithelial cells during inflammation.
19907439 2010 A20 is targeted by promoter methylation, deletion and inactivating mutation in MALT lymphoma.
19902201 2009 Association of TNFAIP3 polymorphism with rheumatic heart disease in Chinese Han population.
19879194 2009 Integration of genetic risk factors into a clinical algorithm for multiple sclerosis susceptibility: a weighted genetic risk score.
19851077 2010 Generation of human inflammation-resistant endothelial progenitor cells by A20 gene transfer.
19838193 2009 Genome-wide association study in a Chinese Han population identifies nine new susceptibility loci for systemic lupus erythematosus.
19774492 2010 A single-nucleotide polymorphism of the TNFAIP3 gene is associated with systemic lupus erythematosus in Chinese Han population.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19648161 2010 Mutations in the genes coding for the NF-?B regulating factors I?B? and A20 are uncommon in nodular lymphocyte-predominant Hodgkin's lymphoma.
19643665 2009 The ubiquitin-editing enzyme A20 (TNFAIP3) is a central regulator of immunopathology.
19617629 2009 Adiponectin inhibits pro-inflammatory signaling in human macrophages independent of interleukin-10.
19608751 2009 TNFAIP3/A20 functions as a novel tumor suppressor gene in several subtypes of non-Hodgkin lymphomas.
19565500 2009 Variants in TNFAIP3, STAT4, and C12orf30 loci associated with multiple autoimmune diseases are also associated with juvenile idiopathic arthritis.
19494296 2009 A20 negatively regulates T cell receptor signaling to NF-kappaB by cleaving Malt1 ubiquitin chains.
19492975 2009 A20 is overexpressed in glioma cells and may serve as a potential therapeutic target.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19412163 2009 Frequent inactivation of A20 in B-cell lymphomas.
19387456 2009 Meta-analysis and imputation identifies a 109 kb risk haplotype spanning TNFAIP3 associated with lupus nephritis and hematologic manifestations.
19380639 2009 TNFAIP3 (A20) is a tumor suppressor gene in Hodgkin lymphoma and primary mediastinal B cell lymphoma.
19380636 2009 A20 takes on tumors: tumor suppression by an ubiquitin-editing enzyme.
19366996 2010 Association of the 6q23 region with the rate of joint destruction in rheumatoid arthritis.
19344623 2009 Polymorphisms in the tumour necrosis factor alpha-induced protein 3 (TNFAIP3) gene are associated with chronic rhinosinusitis.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19292917 2009 Analysis of TNFAIP3, a feedback inhibitor of nuclear factor-kappaB and the neighbor intergenic 6q23 region in rheumatoid arthritis susceptibility.
19285159 2009 Identification of polyubiquitin binding proteins involved in NF-kappaB signaling using protein arrays.
19262574 2009 Genome-wide association scan yields new insights into the immunopathogenesis of psoriasis.
19258598 2009 The NF-{kappa}B negative regulator TNFAIP3 (A20) is inactivated by somatic mutations and genomic deletions in marginal zone lymphomas.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19169254 2009 Genome-wide scan reveals association of psoriasis with IL-23 and NF-kappaB pathways.
19165919 2008 Multiple polymorphisms in the TNFAIP3 region are independently associated with systemic lupus erythematosus.
19165918 2008 Genetic variants near TNFAIP3 on 6q23 are associated with systemic lupus erythematosus.
19152111 2009 TNFalpha-induced macrophage death via caspase-dependent and independent pathways.
19131965 2009 The ubiquitin-editing enzyme A20 requires RNF11 to downregulate NF-kappaB signalling.
19124729 2009 Attenuated expression of A20 markedly increases the efficacy of double-stranded RNA-activated dendritic cells as an anti-cancer vaccine.
19110536 2009 Analysis of 17 autoimmune disease-associated variants in type 1 diabetes identifies 6q23/TNFAIP3 as a susceptibility locus.
18952128 2009 The zinc finger protein A20 targets TRAF2 to the lysosomes for degradation.
18814951 2008 Gene-expression profiles of peripheral blood mononuclear cell subpopulations in acute graft-vs-host disease following cord blood transplantation.
18813897 2008 The A20 gene protects kidneys from ischaemia/reperfusion injury by suppressing pro-inflammatory activation.
18794853 2008 Common variants at CD40 and other loci confer risk of rheumatoid arthritis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18349075 2008 A20 is a negative regulator of BCL10- and CARMA3-mediated activation of NF-kappaB.
18223652 2008 T cell antigen receptor stimulation induces MALT1 paracaspase-mediated cleavage of the NF-kappaB inhibitor A20.
18164316 2008 Molecular basis for the unique deubiquitinating activity of the NF-kappaB inhibitor A20.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17982456 2007 Two independent alleles at 6q23 associated with risk of rheumatoid arthritis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17962196 2008 Interplay between E-box and NF-kappaB in regulation of A20 gene by DRB sensitivity-inducing factor (DSIF).
17961127 2008 Structure of the A20 OTU domain and mechanistic insights into deubiquitination.
17953374 2007 [Expressions of cytoprotective proteins for human renal allografts].
17886247 2008 TNFAIP3 is the target gene of chromosome band 6q23.3-q24.1 loss in ocular adnexal marginal zone B cell lymphoma.
17297453 2007 A20/TNFAIP3, a new estrogen-regulated gene that confers tamoxifen resistance in breast cancer cells.
17259397 2007 Tag polymorphisms at the A20 (TNFAIP3) locus are associated with lower gene expression and increased risk of coronary artery disease in type 2 diabetes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16936197 2006 Nuclear factor-kappaB regulates beta-cell death: a critical role for A20 in beta-cell protection.
16824518 2006 A new role for the anti-apoptotic gene A20 in angiogenesis.
16816117 2006 A20, a modulator of smooth muscle cell proliferation and apoptosis, prevents and induces regression of neointimal hyperplasia.
16684768 2006 ABIN-1 binds to NEMO/IKKgamma and co-operates with A20 in inhibiting NF-kappaB.
16474993 2006 Neuroprotective effect of A20 on TNF-induced postischemic apoptosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16306043 2006 Negative regulation of the retinoic acid-inducible gene I-induced antiviral state by the ubiquitin-editing protein A20.
16164629 2005 Combined expression of A1 and A20 achieves optimal protection of renal proximal tubular epithelial cells.
15862966 2005 A20 gene expression is regulated by TNF, Vitamin D and androgen in prostate cancer cells.
15661910 2005 A20 is a negative regulator of IFN regulatory factor 3 signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474016 2004 A20 is a potent inhibitor of TLR3- and Sendai virus-induced activation of NF-kappaB and ISRE and IFN-beta promoter.
15258597 2004 De-ubiquitination and ubiquitin ligase domains of A20 downregulate NF-kappaB signalling.
15251990 2004 A20 protects endothelial cells from TNF-, Fas-, and NK-mediated cell death by inhibiting caspase 8 activation.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15169888 2004 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability.
15142865 2004 A20 inhibits toll-like receptor 2- and 4-mediated interleukin-8 synthesis in airway epithelial cells.
14754897 2004 ZNF216 Is an A20-like and IkappaB kinase gamma-interacting inhibitor of NFkappaB activation.
14748687 2004 Zinc-finger protein A20, a regulator of inflammation and cell survival, has de-ubiquitinating activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12965196 2003 Identification of Naf1/ABIN-1 among TNF-alpha-induced expressed genes in human synoviocytes using oligonucleotide microarrays.
12885753 2003 A20 protects from CD40-CD40 ligand-mediated endothelial cell activation and apoptosis.
12794157 2003 Genetic engineering of a suboptimal islet graft with A20 preserves beta cell mass and function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167698 2002 A20 inhibits tumor necrosis factor (TNF) alpha-induced apoptosis by disrupting recruitment of TRADD and RIP to the TNF receptor 1 complex in Jurkat T cells.
12080044 2002 The promyelocytic leukemia protein represses A20-mediated transcription.
11594795 2001 A20 inhibits NF-kappa B activation downstream of multiple Map3 kinases and interacts with the I kappa B signalosome.
11573245 2001 Expression of different NF-kappaB pathway genes in dendritic cells (DCs) or macrophages assessed by gene expression profiling.
11463333 2001 Isolation and characterization of two novel A20-like proteins.
11390377 2001 Identification of a novel A20-binding inhibitor of nuclear factor-kappa B activation termed ABIN-2.
11389905 2001 Functional redundancy of the zinc fingers of A20 for inhibition of NF-kappaB activation and protein-protein interactions.
11009421 2000 Failure to regulate TNF-induced NF-kappaB and cell death responses in A20-deficient mice.
10755617 2000 Recruitment of the IKK signalosome to the p55 TNF receptor: RIP and A20 bind to NEMO (IKKgamma) upon receptor stimulation.
10435631 1999 The zinc finger protein A20 interacts with a novel anti-apoptotic protein which is cleaved by specific caspases.
10385526 1999 The zinc finger protein A20 inhibits TNF-induced NF-kappaB-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal and directly binds to a novel NF-kappaB-inhibiting protein ABIN.
9928991 1999 The cytokine-inducible zinc finger protein A20 inhibits IL-1-induced NF-kappaB activation at the level of TRAF6.
9882303 1999 Epstein-Barr virus-encoded latent membrane protein 1 activates the JNK pathway through its extreme C terminus via a mechanism involving TRADD and TRAF2.
9299557 1997 A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins.
8797804 1996 A20, an inhibitor of cell death, self-associates by its zinc finger domain.
8702721 1996 14-3-3 proteins associate with A20 in an isoform-specific manner and function both as chaperone and adapter molecules.
8692885 1996 The tumor necrosis factor-inducible zinc finger protein A20 interacts with TRAF1/TRAF2 and inhibits NF-kappaB activation.
8663499 1996 A20 blocks endothelial cell activation through a NF-kappaB-dependent mechanism.
2406243 1990 Tumor necrosis factor-alpha induction of novel gene products in human endothelial cells including a macrophage-specific chemotaxin.
2118515 1990 The A20 cDNA induced by tumor necrosis factor alpha encodes a novel type of zinc finger protein.