Property Summary

NCBI Gene PubMed Count 23
PubMed Score 59.22
PubTator Score 28.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis 1.787 1.2e-02
adrenocortical carcinoma -1.214 5.2e-03
cystic fibrosis 1.412 9.9e-04
cystic fibrosis and chronic rhinosinusit... 1.143 9.8e-03
ependymoma 1.100 2.2e-02
gastric carcinoma 1.700 2.1e-02
Gaucher disease type 1 1.300 4.9e-03
glioblastoma 1.400 1.5e-03
head and neck cancer 1.400 2.4e-03
interstitial cystitis -1.100 4.7e-03
intraductal papillary-mucinous neoplasm ... 2.100 5.6e-03
lung cancer -1.200 4.7e-03
lung carcinoma -1.400 6.4e-22
mucosa-associated lymphoid tissue lympho... 1.438 4.6e-02
osteosarcoma 1.869 1.5e-06
ovarian cancer 1.400 1.8e-07
pancreatic cancer 1.100 4.0e-03
pancreatic ductal adenocarcinoma liver m... 1.631 4.7e-02
psoriasis 1.400 9.2e-03
subependymal giant cell astrocytoma 1.342 2.7e-02
X-linked cerebral adrenoleukodystrophy -1.100 4.7e-02

Gene RIF (18)

AA Sequence

MSEASSEDLVPPLEAGAAPYREEEEAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQ      1 - 70
GLDGPPPTVEELKAALERGQLEAARPLLALERELAAAAAAGGVSEEELVRRQSKVEALYELLRDQVLGVL     71 - 140
RRPLEAPPERLRQALAVVAEQEREDRQAAAAGPGTSGLAATRPRRWLQLWRRGVAEAAEERMGQRPAAGA    141 - 210
EVPESVFLHLGRTMKEDLEAVVERLKPLFPAEFGVVAAYAESYHQHFAAHLAAVAQFELCERDTYMLLLW    211 - 280
VQNLYPNDIINSPKLVGELQGMGLGSLLPPRQIRLLEATFLSSEAANVRELMDRALELEARRWAEDVPPQ    281 - 350
RLDGHCHSELAIDIIQITSQAQAKAESITLDLGSQIKRVLLVELPAFLRSYQRAFNEFLERGKQLTNYRA    351 - 420
NVIANINNCLSFRMSMEQNWQVPQDTLSLLLGPLGELKSHGFDTLLQNLHEDLKPLFKRFTHTRWAAPVE    421 - 490
TLENIIATVDTRLPEFSELQGCFREELMEALHLHLVKEYIIQLSKGRLVLKTAEQQQQLAGYILANADTI    491 - 560
QHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRI    561 - 630
RSILDVSMGAQEPSRPLFSLIKVG                                                  631 - 654
//

Text Mined References (24)

PMID Year Title