Property Summary

NCBI Gene PubMed Count 34
PubMed Score 18.96
PubTator Score 20.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.083 1.5e-05
atypical teratoid / rhabdoid tumor 1.200 4.1e-06
medulloblastoma, large-cell 1.100 3.0e-05
intraductal papillary-mucinous neoplasm ... -1.200 5.2e-03
lung cancer -1.100 2.5e-03
group 4 medulloblastoma 1.100 4.2e-03
lung adenocarcinoma -1.100 3.4e-12
ovarian cancer 1.300 4.9e-04

Synonym

Accession Q13829 B7Z6M4 Q5TZQ1 hBACURD2
Symbols B12
B61
EDP1
BTBD34
hBACURD2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (18)

PMID Text
26398148 CREB is a negative regulator of the TNFAIP1 gene.
26261520 TNFAIP1 plays an important role in mediating miR-15a dependent biological functions in osteosarcoma.
26152285 MiR-181a played a critical role in regulating pancreatic cancer growth and migration, likely interacting with TNFAIP1.
24969828 Results showed that the expression of TNFAIP1 protein was significantly increased in osteosarcoma tissues and associated with distant metastasis.
23912453 Expression of TNFAIP1 is regulated by the transcriptional factor Sp1.
22810651 TNFAIP1 inhibited the transcriptional activities of nuclear factor kappa B (NF-kappaB) and activating protein-1 reporters
20158880 suggest that the TNFAIP1/POLDIP2 complex sense-antisense architecture represents a clinically significant transcriptional structural-functional gene module associated with amplification of the genomic region on 17q11.2 in breast cancer.
19851886 CK2 could phosphorylate TNFAIP1 in vitro and in vivo, which facilitated the distribution of TNFAIP1 in nucleus and enhanced its interaction with PCNA.
19593659 The promoter region of human TNFAIP1 gene was functionally characterized.
19196817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16870576 Expression levels of TNFAIP1 are high in COS7 and NIH3T3 cell lines but low in the cancer cell lines.
12600716 TNFAIP1 shows increased transcript levels in Alzheimer's disease brains
12039524 Observational study of gene-disease association. (HuGE Navigator)
11929592 Observational study of gene-disease association. (HuGE Navigator)
11849463 Observational study of gene-disease association. (HuGE Navigator)
11791643 Observational study of gene-disease association. (HuGE Navigator)
11704801 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11702059 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGDTCLCPASGAKPKLSGFKGGGLGNKYVQLNVGGSLYYTTVRALTRHDTMLKAMFSGRMEVLTDKEGW      1 - 70
ILIDRCGKHFGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPII     71 - 140
TSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELFDKLSLRFNGRVLFIKDVIGDEICC    141 - 210
WSFYGQGRKLAEVCCTSIVYATEKKQTKVEFPEARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPS    211 - 280
EDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD                                      281 - 316
//

Text Mined References (39)

PMID Year Title
26398148 2015 Transcription factor cyclic adenosine monophosphate responsive element binding protein negatively regulates tumor necrosis factor alpha-induced protein 1 expression.
26261520 2015 MiRNA-15a inhibits proliferation, migration and invasion by targeting TNFAIP1 in human osteosarcoma cells.
26152285 2015 Interaction between microRNA-181a and TNFAIP1 regulates pancreatic cancer proliferation and migration.
25416956 2014 A proteome-scale map of the human interactome network.
25080503 2014 Meta-analysis of genome-wide association studies identifies two loci associated with circulating osteoprotegerin levels.
24969828 2014 Knockdown of TNFAIP1 inhibits growth and induces apoptosis in osteosarcoma cells through inhibition of the nuclear factor-?B pathway.
23912453 2014 Role of tumor necrosis factor alpha-induced protein 1 in paclitaxel resistance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22810651 2012 TNFAIP1 interacts with KCTD10 to promote the degradation of KCTD10 proteins and inhibit the transcriptional activities of NF-?B and AP-1.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20158880 2010 Complex sense-antisense architecture of TNFAIP1/POLDIP2 on 17q11.2 represents a novel transcriptional structural-functional gene module involved in breast cancer progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851886 2010 CK2 phosphorylates TNFAIP1 to affect its subcellular localization and interaction with PCNA.
19782033 2009 Cullin mediates degradation of RhoA through evolutionarily conserved BTB adaptors to control actin cytoskeleton structure and cell movement.
19637314 2009 RhoB induces apoptosis via direct interaction with TNFAIP1 in HeLa cells.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19593659 2010 Functional characterization of the promoter region of human TNFAIP1 gene.
19196817 2009 Joint effect of obesity and TNFA variability on asthma: two international cohort studies.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16870576 2006 [Expression profile in the cell lines of human TNFAIP1 gene].
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12600716 Gene expression analysis in a transgenic Caenorhabditis elegans Alzheimer's disease model.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12039524 2002 TNF-alpha, IL1-beta, and immunoglobulin (GM and KM) gene polymorphisms in sarcoidosis.
11929592 2001 Strong association of a tumor necrosis factor-alpha promoter allele with cerebral malaria in Myanmar.
11849463 2002 Polymorphism of the cytokine genes and IgA nephropathy.
11791643 Influence of HLA-DRB1 and TNF microsatellite polymorphisms on the expression of extraarticular manifestations in rheumatoid arthritis patients from northwest Spain.
11704801 2001 Tumor necrosis factor-alpha promoter polymorphisms in Mexican patients with systemic lupus erythematosus (SLE).
11702059 2001 Analysis of tumor necrosis factor-alpha gene promoter polymorphisms in anorexia nervosa.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
7536959 1995 Role of B61, the ligand for the Eck receptor tyrosine kinase, in TNF-alpha-induced angiogenesis.
2406243 1990 Tumor necrosis factor-alpha induction of novel gene products in human endothelial cells including a macrophage-specific chemotaxin.
2233719 1990 A novel immediate-early response gene of endothelium is induced by cytokines and encodes a secreted protein.
1370465 1992 Characterization of a novel tumor necrosis factor-alpha-induced endothelial primary response gene.