Property Summary

NCBI Gene PubMed Count 36
PubMed Score 21.57
PubTator Score 20.27

Knowledge Summary


No data available



  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.1e-06
group 4 medulloblastoma 1.100 4.2e-03
intraductal papillary-mucinous neoplasm ... -1.200 5.2e-03
lung adenocarcinoma -1.100 3.4e-12
lung cancer -1.100 2.5e-03
medulloblastoma, large-cell 1.100 3.0e-05
osteosarcoma -2.083 1.5e-05
ovarian cancer 1.300 4.9e-04

Protein-protein Interaction (2)

Gene RIF (19)

AA Sequence

EDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD                                      281 - 316

Text Mined References (41)

PMID Year Title