Property Summary

NCBI Gene PubMed Count 4,822
PubMed Score 50044.65
PubTator Score 39486.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count
psoriasis 6685
Atherosclerosis 275
Obesity 616
Asthma 349
Malaria 140
Leishmaniasis 49
Alzheimer's disease 644
Anemia 252
Pleurisy 18
Listeriosis 17
Cholestasis 93
Schizophrenia 503
Brain Ischemia 87
Urticaria 53
AMYOTROPHIC LATERAL SCLEROSIS 1 49
ASTHMA, SUSCEPTIBILITY TO (finding) 6
Acute coronary syndrome 37
Acute kidney injury 65
Adenocarcinoma 115
Albuminuria 20
Anemia, Sickle Cell 10
Anorexia 15
Anthracosis 4
Anxiety Disorders 37
Arsenic Poisoning 59
Arthritis, Experimental 39
Arthritis, Infectious 2
Arthritis, Psoriatic 15
Berylliosis 28
Bladder Neoplasm 109
Brain edema 26
Bronchiectasis 29
Cachexia 10
Carcinoma, Transitional Cell 31
Cardiac arrest 26
Cardiomegaly 66
Cardiomyopathies 90
Cardiovirus Infections 2
Cerebrovascular accident 44
Chlamydia Infections 2
Cholestasis of pregnancy 5
Chronic Obstructive Airway Disease 47
Colitis 46
Colonic Neoplasms 126
Colorectal Neoplasms 217
Compression of spinal cord 3
Coronary Restenosis 8
Crohn Disease 97
Dermatitis, Allergic Contact 66
Dermatologic disorders 65
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Insulin-Dependent 77
Diabetes Mellitus, Non-Insulin-Dependent 161
Diabetic Cardiomyopathies 10
Diaphragmatic Hernia 40
Drug allergy 36
Drug-Induced Liver Injury 118
Edema 38
Fanconi Anemia 22
Fatty Liver 48
Fever 34
Fibromatosis, Aggressive 2
Fibrosis 40
Gastric ulcer 34
Glioma 66
Glomerulonephritis 36
HIV Wasting Syndrome 4
Heart failure 80
Heat Stroke 12
Hemochromatosis 55
Hepatic encephalopathy 25
Hepatitis, Alcoholic 2
Hepatolenticular Degeneration 24
Hyperalgesia 71
Hyperbilirubinemia 4
Hypercalcemia 37
Hyperhomocysteinemia 34
Hypersensitivity 63
Hypertensive disease 193
Hypoglycemia 81
Hypotension 53
Hypothermia, natural 12
Infection 5
Inflammation 109
Inflammatory Bowel Diseases 87
Insulin Resistance 50
Kidney Failure, Chronic 45
Leishmaniasis, Cutaneous 8
Leishmaniasis, Visceral 13
Liver Cirrhosis, Alcoholic 16
Liver Cirrhosis, Experimental 108
Liver Failure, Acute 22
Liver diseases 66
Liver neoplasms 109
Localized scleroderma 9
Lung Injury 20
Lung Neoplasms 171
Lung diseases 48
Lytic lesion 7
MALARIA, CEREBRAL, SUSCEPTIBILITY TO (finding) 3
Mammary Neoplasms 410
Manganese Poisoning 11
Melanoma 261
Migraine Disorders 26
Mitochondrial Myopathies 6
Multiple Organ Failure 6
Myocardial Infarction 126
Myocardial Ischemia 169
Myocardial stunning 8
Myocarditis 17
Nausea 9
Necrosis 51
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Neoplasms, Experimental 33
Nerve Degeneration 73
Neuralgia 16
Neurogenic Inflammation 12
Oral Submucous Fibrosis 18
Osteoporosis, Postmenopausal 7
PLASMODIUM FALCIPARUM BLOOD INFECTION LEVEL 4
PSORIATIC ARTHRITIS, SUSCEPTIBILITY TO (finding) 2
Pain 70
Pancreatic Neoplasm 79
Parkinson Disease 105
Peripheral Neuropathy 303
Placenta Disorders 4
Pleural effusion disorder 1
Pneumonia 133
Polymyositis 5
Pregnancy Complications, Cardiovascular 4
Pulmonary Fibrosis 66
Pulmonary edema 14
Pulmonary hypertension 52
Refractory anemias 2
Reperfusion Injury 84
Respiratory Hypersensitivity 18
Respiratory Tract Diseases 6
Retinal Diseases 21
Sarcoma 49
Sepsis 21
Septic Shock 5
Shock, Hemorrhagic 7
Soft Tissue Neoplasms 3
Stable angina 3
Status Epilepticus 85
Stomach Neoplasms 282
Tachycardia 17
Thrombosis 42
Thyroid Neoplasm 33
Vascular Diseases 16
Venous Thromboembolism 34
Ventricular Dysfunction 7
Weight Gain 87
dermatomyositis 967
hemolytic-uremic syndrome 28
nervous system disorder 53
Disease Target Count P-value
pilocytic astrocytoma 3086 7.77280487469844E-4
osteosarcoma 7933 9.63028729939556E-4
interstitial cystitis 2299 0.00329952434212328
mucosa-associated lymphoid tissue lymphoma 480 0.00750890168747562
acute myeloid leukemia 785 0.0265523687125971
Disease Target Count Z-score Confidence
Inflammatory bowel disease 142 7.342 3.7
Cancer 2346 6.776 3.4
Lung disease 136 6.417 3.2
tuberculosis 1563 6.348 3.2
Hypersensitivity reaction type II disease 235 6.307 3.2
diabetes mellitus 1663 6.129 3.1
Liver disease 219 5.805 2.9
Multiple Sclerosis 498 5.731 2.9
Kidney disease 397 5.725 2.9
Osteoarthritis 96 5.599 2.8
periodontitis 269 5.589 2.8
Dermatitis 141 5.569 2.8
Vasculitis 64 5.563 2.8
Uveitis 103 5.512 2.8
Coronary artery disease 240 5.358 2.7
Pancreatitis 97 5.358 2.7
Peritonitis 37 5.341 2.7
Acquired immunodeficiency syndrome 164 5.265 2.6
Heart disease 279 5.236 2.6
Synovitis 72 5.19 2.6
Cerebrovascular disease 231 5.091 2.5
Metabolic syndrome X 155 5.049 2.5
sarcoidosis 368 4.946 2.5
Influenza 142 4.916 2.5
Brain disease 84 4.875 2.4
Meningitis 46 4.814 2.4
Arthropathy 34 4.812 2.4
Allergic hypersensitivity disease 123 4.808 2.4
Osteoporosis 259 4.602 2.3
Hyperglycemia 120 4.586 2.3
Dry eye syndrome 14 4.572 2.3
Fatty liver disease 86 4.569 2.3
Toxic shock syndrome 28 4.51 2.3
Neuropathy 210 4.506 2.3
Diarrhea 155 4.494 2.2
Leukopenia 42 4.473 2.2
Toxic encephalopathy 131 4.455 2.2
Endometriosis 535 4.396 2.2
Hepatitis B 103 4.396 2.2
Mastitis 48 4.35 2.2
Myopathy 128 4.346 2.2
Leprosy 77 4.294 2.1
Hepatitis C 90 4.259 2.1
Bronchitis 44 4.164 2.1
Gastritis 44 4.118 2.1
Lipid metabolism disorder 102 4.094 2.0
Chagas disease 34 4.073 2.0
cystic fibrosis 1670 4.055 2.0
Kawasaki disease 24 4.05 2.0
Dementia 129 4.023 2.0
Chorioamnionitis 15 3.993 2.0
Eosinophilia 65 3.943 2.0
Obstructive sleep apnea 28 3.941 2.0
Collagen disease 25 3.937 2.0
Paracoccidioidomycosis 11 3.915 2.0
Diabetic Retinopathy 53 3.895 1.9
Otitis media 32 3.883 1.9
Parkinson's disease 364 3.881 1.9
Allergic rhinitis 92 3.854 1.9
Dengue disease 19 3.828 1.9
Exanthem 39 3.818 1.9
Primary immunodeficiency disease 52 3.789 1.9
Lichen planus 17 3.749 1.9
Schistosomiasis 38 3.673 1.8
Tetanus 66 3.669 1.8
Perinatal necrotizing enterocolitis 18 3.615 1.8
Keratitis 42 3.605 1.8
Thrombocytopenia 105 3.596 1.8
Infertility 163 3.575 1.8
Common cold 63 3.53 1.8
Prostatitis 15 3.487 1.7
Brucellosis 24 3.475 1.7
Reactive arthritis 7 3.416 1.7
Gout 93 3.408 1.7
Hyperinsulinism 63 3.378 1.7
Spinal cord disease 22 3.358 1.7
Major Depressive Disorder 106 3.336 1.7
Sinusitis 30 3.333 1.7
Pneumocystosis 18 3.326 1.7
SAPHO syndrome 10 3.326 1.7
Hemophagocytic lymphohistiocytosis 30 3.324 1.7
Candidiasis 48 3.319 1.7
adult-onset Still's disease 6 3.318 1.7
Takayasu's arteritis 54 3.312 1.7
Irritable bowel syndrome 59 3.308 1.7
Histoplasmosis 22 3.304 1.7
Septic arthritis 8 3.297 1.6
Polyneuropathy 30 3.277 1.6
Cholangitis 20 3.261 1.6
Cystitis 16 3.261 1.6
Toxoplasmosis 16 3.234 1.6
Disseminated intravascular coagulation 32 3.219 1.6
Amyloidosis 68 3.216 1.6
Herpes zoster 7 3.212 1.6
Osteomyelitis 20 3.174 1.6
Degenerative disc disease 28 3.155 1.6
Chronic fatigue syndrome 29 3.127 1.6
Glaucoma 135 3.112 1.6
Aspergillosis 23 3.103 1.6
Gingivitis 19 3.09 1.5
Progressive multifocal leukoencephalopathy 24 3.088 1.5
Age related macular degeneration 84 3.074 1.5
Lipodystrophy 32 3.072 1.5
Scleritis 5 3.071 1.5
Aortic aneurysm 34 3.057 1.5
Hypohidrotic ectodermal dysplasia 14 3.036 1.5
Portal hypertension 21 3.035 1.5
Polycystic Ovary Syndrome 335 3.034 1.5
Bipolar Disorder 266 3.023 1.5
Disease Target Count
Psoriatic arthritis 85

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.332 0.001
tuberculosis -1.900 0.003
interstitial cystitis 1.500 0.003
pilocytic astrocytoma 1.500 0.001
Bipolar Disorder 3.008 0.039
mucosa-associated lymphoid tissue lympho... 1.129 0.008
acute myeloid leukemia 1.200 0.027
See source...

Synonym

Accession P01375 O43647 Q9P1Q2 Q9UIV3
Symbols DIF
TNFA
TNFSF2
TNLG1F
TNF-alpha

Gene

TNF

PDB

1A8M   1TNF   2AZ5   2E7A   2TUN   2ZJC   2ZPX   3ALQ   3IT8   3L9J   3WD5   4G3Y   4TSV   4TWT   5TSW  

  Ortholog (8)

Species Source
Chimp OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
1852 other 1149 / 0 / 1332 HTS assay for identification of inhibitors of TNF-a-specific NF-kB induction
2337 confirmatory 166 / 0 / 138 SAR analysis of inhibitors of TNFa specific NF-kB induction revised
2483 confirmatory 8 / 0 / 12 SAR analysis of inhibitors of TNFa specific NF-kB induction - Set 2
2485 confirmatory 437 / 0 / 109 HTS dose response assay for identification of inhibitors of TNFa-specific NF-kB induction
2801 confirmatory 8 / 0 / 32 SAR analysis of inhibitors of TNFa specific NF-kB induction - Set 3

Gene RIF (5478)

PMID Text
27301136 Effect of tumor necrosis factor-alpha and the importance of its gene polymorphism on the progression of chronic hepatitis C (CHC) and ulcerative colitis (UC).
27213791 The frequency of TNF-308 GA genotype was higher in Age-related macular degeneration patients than in the controls, while the TNF-308 capital A, CyrillicA minor genotype has proved protective against the disease.
27175496 These data determined that TNF-alpha(-308) polymorphisms can influence the chronicity of hepatitis B and C infections.
27055013 Dynorphin 1-17 and Its N-Terminal Biotransformation Fragments Modulate Lipopolysaccharide-Stimulated Nuclear Factor-kappa B Nuclear Translocation, Interleukin-1beta and Tumor Necrosis Factor-alpha
27051065 findings provide evidence for the asymmetric arginine dimethylation of RelA and unveil a unique mechanism controlling TNFalpha/NF-kappaB signaling.
27029120 Significant differences in distribution of genotypes and alleles of genes IL-10 and TNF-alpha in the group of patients with periodontitis and comparison group were not detected.
27025058 Inhibition of IRE1 modifies effect of glucose deprivation on the expression of TNFalpha-related genes in glioma cells.
27010153 The levels of ESM1, CLDN5, IL-1beta, IL-6, and TNF-alpha were significantly higher in the migraine attack group than in the control group
26996127 autophagy plays a key role in TiAl6V4 particle-induced osteolysis by promoting TNF-alpha expression
26975025 These findings can help to provide a better understanding of the effect of long-term usage of anti-VEGF agents in the treatment of retinal degenerative and vitreoretinopathy diseases.
More...

AA Sequence

MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLI      1 - 70
SPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLF     71 - 140
KGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSA    141 - 210
EINRPDYLDFAESGQVYFGIIAL                                                   211 - 233
//

Text Mined References (4826)

PMID Year Title
27301136 2016 [THE INFLUENCE OF TUMOR NECROSIS FACTOR ALPHA AND POLYMORPHISM OF ITS GENE (RS1800629) ON THE SEVERITY AND PROGRESSION OF CHRONIC HEPATITIS AND ULCERATIVE COLITIS].
27213791 [Cytokine gene polymorphisms in patients with age-related macular degeneration].
27175496 2016 [Investigation of the association between chronic hepatitis B and C infections and TNF-? (-308) gene polymorphism].
27055013 2016 Dynorphin 1-17 and Its N-Terminal Biotransformation Fragments Modulate Lipopolysaccharide-Stimulated Nuclear Factor-kappa B Nuclear Translocation, Interleukin-1beta and Tumor Necrosis Factor-alpha in Differentiated THP-1 Cells.
27051065 2016 Asymmetric arginine dimethylation of RelA provides a repressive mark to modulate TNF?/NF-?B response.
27029120 [ASSOCIATION OF POLYMORPHIC MARKERS IN GENES OF INNATE IMMUNITY IN PATIENTS WITH PERIODONTITIS AND INFLAMMATORY DISEASES OF UPPER RESPIRATORY TRACT].
27025058 INHIBITION OF IRE1 MODIFIES EFFECT OF GLUCOSE DEPRIVATION ON THE EXPRESSION OF TNF?-RELATED GENES IN U87 GLIOMA CELLS.
27010153 2016 Serum levels of endocan, claudin-5 and cytokines in migraine.
26996127 2016 Autophagy mediated TiAl?V? particle-induced peri-implant osteolysis by promoting expression of TNF-?.
26975025 2016 Short Pulse of Clinical Concentration of Bevacizumab Modulates Human Retinal Pigment Epithelial Functionality.
More...