Property Summary

Ligand Count 308
NCBI Gene PubMed Count 5,174
PubMed Score 50345.55
PubTator Score 39486.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
psoriasis 6694 6.552 3.3
Atherosclerosis 291 6.129 3.1
Obesity 678 6.024 3.0
Asthma 385 5.933 3.0
Malaria 160 5.367 2.7
Leishmaniasis 47 5.223 2.6
Hypertension 396 5.14 2.6
Anemia 365 4.77 2.4
Pleurisy 19 4.059 2.0
Listeriosis 18 4.052 2.0
Cholestasis 155 3.77 1.9
Schizophrenia 1160 3.488 1.7
Urticaria 67 3.138 1.6
Brain Ischemia 110 3.013 1.5
AMYOTROPHIC LATERAL SCLEROSIS 1 49 0.0 0.0
Acute coronary syndrome 39 0.0 0.0
Acute kidney injury 70 0.0 0.0
Adenocarcinoma 122 0.0 0.0
Albuminuria 21 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Anemia, Refractory 1 0.0 0.0
Anemia, Sickle Cell 8 0.0 0.0
Angina, Stable 3 0.0 0.0
Anorexia 43 0.0 0.0
Anthracosis 4 0.0 0.0
Anxiety Disorders 38 0.0 0.0
Arsenic Poisoning 62 0.0 0.0
Arthritis, Experimental 39 0.0 0.0
Arthritis, Infectious 3 0.0 0.0
Arthritis, Psoriatic 14 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Asbestosis 20 0.0 0.0
Asthma, Occupational 10 0.0 0.0
Berylliosis 28 0.0 0.0
Brain Edema 50 0.0 0.0
Brain Injuries 65 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Bronchiectasis 64 0.0 0.0
Burns 9 0.0 0.0
Cachexia 50 0.0 0.0
Carcinoma, Hepatocellular 228 0.0 0.0
Carcinoma, Transitional Cell 32 0.0 0.0
Cardiomegaly 116 0.0 0.0
Cardiomyopathies 110 0.0 0.0
Cardiovirus Infections 2 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Chlamydia Infections 2 0.0 0.0
Cholestasis, Extrahepatic 25 0.0 0.0
Colitis 54 0.0 0.0
Colitis, Ulcerative 59 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Coronary Restenosis 8 0.0 0.0
Coxsackievirus Infections 6 0.0 0.0
Crohn Disease 45 0.0 0.0
Dermatitis, Allergic Contact 67 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 1 43 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Diabetic Cardiomyopathies 10 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Drug Hypersensitivity 34 0.0 0.0
Edema 81 0.0 0.0
Fanconi anemia 56 0.0 0.0
Fatty Liver 70 0.0 0.0
Fever 138 0.0 0.0
Fibromatosis, Aggressive 3 0.0 0.0
Fibrosis 44 0.0 0.0
Glioma 74 0.0 0.0
Glomerulonephritis 46 0.0 0.0
HIV Wasting Syndrome 4 0.0 0.0
Heart Arrest 3 0.0 0.0
Heart failure 162 0.0 0.0
Heat Stroke 13 0.0 0.0
Hemochromatosis 54 0.0 0.0
Hemolytic-Uremic Syndrome 30 0.0 0.0
Hepatic encephalopathy 27 0.0 0.0
Hepatitis, Alcoholic 5 0.0 0.0
Hepatolenticular Degeneration 24 0.0 0.0
Hernia, Diaphragmatic 40 0.0 0.0
Hyperalgesia 83 0.0 0.0
Hyperbilirubinemia 4 0.0 0.0
Hypercalcemia 59 0.0 0.0
Hyperhomocysteinemia 37 0.0 0.0
Hypersensitivity 63 0.0 0.0
Hypertension, Pulmonary 37 0.0 0.0
Hypoglycemia 152 0.0 0.0
Hypotension 82 0.0 0.0
Hypothermia 12 0.0 0.0
Infection 6 0.0 0.0
Inflammation 120 0.0 0.0
Inflammatory Bowel Diseases 35 0.0 0.0
Insulin Resistance 72 0.0 0.0
Intrahepatic Cholestasis of Pregnancy 4 0.0 0.0
Kidney Failure, Chronic 46 0.0 0.0
Leishmaniasis, Cutaneous 8 0.0 0.0
Leishmaniasis, Visceral 13 0.0 0.0
Liver Cirrhosis, Alcoholic 16 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver Failure, Acute 29 0.0 0.0
Liver Neoplasms, Experimental 59 0.0 0.0
Liver diseases 87 0.0 0.0
Liver neoplasms 130 0.0 0.0
Lung Injury 20 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Lung diseases 50 0.0 0.0
MIGRAINE WITH OR WITHOUT AURA, SUSCEPTIBILITY TO, 1 3 0.0 0.0
Manganese Poisoning 11 0.0 0.0
Melanoma 711 0.0 0.0
Mitochondrial Myopathies 21 0.0 0.0
Multiple Organ Failure 8 0.0 0.0
Muscular atrophy 71 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Myocardial stunning 8 0.0 0.0
Myocarditis 18 0.0 0.0
Nausea 20 0.0 0.0
Necrosis 53 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Neoplasms, Experimental 40 0.0 0.0
Nerve Degeneration 121 0.0 0.0
Nervous System Diseases 53 0.0 0.0
Neuralgia 20 0.0 0.0
Neurogenic Inflammation 12 0.0 0.0
Oral Submucous Fibrosis 20 0.0 0.0
Osteolysis 7 0.0 0.0
Osteoporosis, Postmenopausal 6 0.0 0.0
Pain 103 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Parkinson Disease 64 0.0 0.0
Placenta Diseases 4 0.0 0.0
Pleural Effusion 1 0.0 0.0
Pneumonia 174 0.0 0.0
Polymyositis 5 0.0 0.0
Pregnancy Complications, Cardiovascular 4 0.0 0.0
Premature Birth 77 0.0 0.0
Pulmonary Disease, Chronic Obstructive 31 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
Pulmonary edema 17 0.0 0.0
Pulmonary emphysema 48 0.0 0.0
Radiation Injuries, Experimental 11 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Respiratory Hypersensitivity 19 0.0 0.0
Respiratory Tract Diseases 6 0.0 0.0
Retinal Diseases 55 0.0 0.0
Sarcoma 62 0.0 0.0
Scleroderma, Localized 3 0.0 0.0
Sepsis 24 0.0 0.0
Shock, Hemorrhagic 7 0.0 0.0
Shock, Septic 6 0.0 0.0
Skin Diseases 71 0.0 0.0
Soft Tissue Neoplasms 3 0.0 0.0
Spinal Cord Compression 3 0.0 0.0
Status Epilepticus 98 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Stomach Ulcer 18 0.0 0.0
Stroke 33 0.0 0.0
Tachycardia 43 0.0 0.0
Thrombosis 46 0.0 0.0
Thyroid Neoplasms 34 0.0 0.0
Trigeminal Neuralgia 24 0.0 0.0
Urinary Bladder Neoplasms 114 0.0 0.0
Vascular Diseases 16 0.0 0.0
Vascular System Injuries 9 0.0 0.0
Venous Thromboembolism 8 0.0 0.0
Ventricular Dysfunction 7 0.0 0.0
Weight Gain 100 0.0 0.0
Wounds and Injuries 18 0.0 0.0
dermatomyositis 966 0.0 0.0
Disease Target Count Z-score Confidence
Inflammatory bowel disease 151 7.405 3.7
Cancer 2499 6.816 3.4
Psoriatic arthritis 86 6.474 3.2
Lung disease 142 6.446 3.2
Hypersensitivity reaction type II disease 253 6.361 3.2
diabetes mellitus 1728 6.106 3.1
Liver disease 237 5.8 2.9
Multiple Sclerosis 540 5.756 2.9
Kidney disease 430 5.692 2.8
Dermatitis 157 5.648 2.8
Osteoarthritis 184 5.644 2.8
periodontitis 293 5.625 2.8
Vasculitis 80 5.611 2.8
Uveitis 103 5.509 2.8
Coronary artery disease 268 5.324 2.7
Acquired immunodeficiency syndrome 197 5.314 2.7
Peritonitis 43 5.311 2.7
Synovitis 78 5.257 2.6
Heart disease 306 5.231 2.6
Pancreatitis 123 5.193 2.6
sarcoidosis 370 5.02 2.5
Influenza 142 5.002 2.5
Cerebrovascular disease 238 4.928 2.5
Arthropathy 43 4.882 2.4
Allergic hypersensitivity disease 126 4.848 2.4
Meningitis 67 4.813 2.4
Brain disease 96 4.783 2.4
Diarrhea 253 4.605 2.3
Osteoporosis 363 4.599 2.3
Dry eye syndrome 18 4.554 2.3
Leukopenia 72 4.52 2.3
Hyperglycemia 137 4.509 2.3
Fatty liver disease 103 4.501 2.3
Hepatitis B 108 4.496 2.2
Neuropathy 261 4.481 2.2
Mastitis 48 4.48 2.2
Toxic shock syndrome 28 4.467 2.2
Myopathy 185 4.384 2.2
Leprosy 73 4.36 2.2
Endometriosis 540 4.342 2.2
Hepatitis C 94 4.304 2.2
Toxic encephalopathy 141 4.296 2.1
Bronchitis 43 4.235 2.1
Gastritis 47 4.214 2.1
Chagas disease 39 4.172 2.1
cystic fibrosis 1696 4.109 2.1
Kawasaki disease 28 4.097 2.0
Chorioamnionitis 14 4.037 2.0
Lipid metabolism disorder 114 4.028 2.0
Obstructive sleep apnea 26 4.018 2.0
Collagen disease 27 4.015 2.0
Dementia 175 4.0 2.0
Paracoccidioidomycosis 12 3.997 2.0
Hypereosinophilic syndrome 71 3.981 2.0
Primary immunodeficiency disease 54 3.954 2.0
Otitis Media 52 3.948 2.0
Allergic rhinitis 95 3.93 2.0
Diabetic retinopathy 56 3.918 2.0
Dengue disease 23 3.91 2.0
Exanthem 37 3.897 1.9
Parkinson's disease 392 3.841 1.9
Lichen planus 16 3.807 1.9
Schistosomiasis 35 3.747 1.9
Tetanus 68 3.746 1.9
Salmonellosis 42 3.666 1.8
Brucellosis 24 3.654 1.8
Thrombocytopenia 197 3.645 1.8
Keratitis 62 3.627 1.8
Infertility 188 3.611 1.8
Common cold 69 3.605 1.8
Retinal Degeneration 106 3.504 1.8
Perinatal necrotizing enterocolitis 21 3.489 1.7
SAPHO syndrome 10 3.48 1.7
Spinal cord disease 25 3.465 1.7
Septic arthritis 8 3.454 1.7
Histoplasmosis 13 3.446 1.7
Candidiasis 55 3.438 1.7
Reactive arthritis 7 3.415 1.7
Herpes zoster 68 3.412 1.7
Takayasu's arteritis 53 3.407 1.7
Osteomyelitis 42 3.405 1.7
Hemophagocytic lymphohistiocytosis 30 3.401 1.7
Toxoplasmosis 17 3.363 1.7
Sinusitis 65 3.359 1.7
Polyneuropathy 64 3.351 1.7
Hyperinsulinism 133 3.337 1.7
adult-onset Still's disease 8 3.337 1.7
Mucositis 29 3.33 1.7
Gout 104 3.326 1.7
Pneumocystosis 17 3.316 1.7
Cholangitis 32 3.285 1.6
Degenerative disc disease 35 3.263 1.6
Prostatitis 18 3.254 1.6
Amyloidosis 67 3.222 1.6
Polycystic ovary syndrome 360 3.222 1.6
Aspergillosis 26 3.215 1.6
Irritable bowel syndrome 60 3.188 1.6
Gingivitis 29 3.187 1.6
Progressive multifocal leukoencephalopathy 25 3.179 1.6
Disseminated intravascular coagulation 38 3.178 1.6
Aortic aneurysm 38 3.152 1.6
Cystitis 15 3.135 1.6
Glaucoma 239 3.114 1.6
Chronic fatigue syndrome 25 3.095 1.5
Tropical spastic paraparesis 15 3.094 1.5
Lipodystrophy 40 3.093 1.5
Chlamydia 21 3.087 1.5
Scleritis 6 3.083 1.5
Melioidosis 17 3.082 1.5
Hypohidrotic ectodermal dysplasia 15 3.032 1.5
Bacterial vaginosis 15 3.005 1.5
Acne 52 3.001 1.5
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (7)

Disease log2 FC p
tuberculosis -1.900 3.1e-03
Bipolar Disorder 3.008 3.9e-02
acute myeloid leukemia 1.200 2.7e-02
Astrocytoma, Pilocytic 1.500 6.1e-04
interstitial cystitis 1.500 3.3e-03
mucosa-associated lymphoid tissue lympho... 1.129 7.5e-03
osteosarcoma -1.332 9.6e-04
See source...

Gene RIF (5828)

AA Sequence

MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLI      1 - 70
SPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLF     71 - 140
KGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSA    141 - 210
EINRPDYLDFAESGQVYFGIIAL                                                   211 - 233
//

Text Mined References (5178)

PMID Year Title