Property Summary

NCBI Gene PubMed Count 198
PubMed Score 2227.43
PubTator Score 998.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 1.0
Vascular disease 281 0.0 2.0
Disease Target Count Z-score Confidence
Nonsyndromic deafness 121 0.0 4.0
Disease Target Count
DEAFNESS, AUTOSOMAL DOMINANT 56 1
Disease Target Count
Deafness, autosomal dominant, 56 1

Expression

  Differential Expression (34)

Disease log2 FC p
Endometriosis 1.280 2.2e-02
interstitial lung disease 1.300 1.7e-02
malignant mesothelioma -6.100 8.2e-10
astrocytoma 3.800 5.6e-03
ependymoma 4.100 1.8e-02
oligodendroglioma 2.300 7.2e-03
uncontrolled asthma 1.300 1.9e-02
glioblastoma multiforme 3.600 5.3e-32
osteosarcoma -2.265 1.6e-03
cystic fibrosis 1.100 9.5e-04
non diabetic and post-ischemic heart fai... -2.100 3.1e-02
Duchenne muscular dystrophy 1.564 2.4e-06
autosomal dominant Emery-Dreifuss muscul... 1.366 2.0e-02
Becker muscular dystrophy 1.520 7.8e-03
juvenile dermatomyositis 1.609 9.1e-08
limb girdle muscular dystrophy 2B 1.161 1.9e-03
acute quadriplegic myopathy 1.083 3.4e-02
Atopic dermatitis 1.400 3.3e-04
non-small cell lung cancer 1.969 3.2e-11
intraductal papillary-mucinous adenoma (... -1.400 4.9e-02
lung cancer 3.000 5.0e-05
colon cancer -2.000 7.8e-03
interstitial cystitis 1.600 3.7e-02
pediatric high grade glioma 2.900 1.8e-05
group 4 medulloblastoma -1.700 1.1e-02
pilocytic astrocytoma 2.100 3.8e-04
non primary Sjogren syndrome sicca -1.300 1.6e-02
subependymal giant cell astrocytoma 2.705 2.8e-02
lung adenocarcinoma 1.900 2.6e-04
lung carcinoma -1.300 1.2e-06
Breast cancer -1.800 4.2e-16
ductal carcinoma in situ 1.700 1.0e-02
ulcerative colitis 4.500 1.4e-06
ovarian cancer 1.900 9.8e-03

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (169)

PMID Text
26731558 Tenascin-C overexpression in cancer cells and stromal fibroblasts was an independent poor prognostic factor for overall survival and disease-free survival esophageal squamous cell carcinoma patients.
26652622 Co-expression of Matrix metalloproteinase-9 and Tenascin-C was associated with poorer prognosis and was found to be an independent predictor of survival
25808872 A pivotal role for TNC in tuning the local immune response to establish equilibrium between disseminated nodal cancer stem cells and the immune system.
25794567 No difference in tenascin-C expression was found in COPD.
25774061 Serum TNC levels are significantly raised and correlate with various clinical and laboratory variables of disease activity in children with enthesitis-related arthritis
25646025 This study has identified tenascin-C as a promoter of the invasiveness of brain tumor-initiating cells through a mechanism involving ADAM-9 proteolysis via the c-Jun NH2-terminal kinase pathway.
25609695 lung cancer patients with Oct4 high, PTEN low and TNC high expression profile significantly correlated with poor disease-free survival
25567561 prepartum and postpartum TN-C serum levels significantly higher in mild and severe preeclampsia than in healthy pregnancy
25515583 the fibronectin type III-like repeats in tenascin-C may be playing an important role in PCO.
25469866 Studied the expression of TNC in tissue microarrays including 17 GBMs, 18 WHO grade III astrocytomas, 15 WHO grade II astrocytomas, 4 WHO grade I astrocytomas, and 7 normal brain tissue samples by immunohistochemical staining.
25448067 miR-133a enhances the protective capacity of cardiac progenitors cells after myocardial infarction
25366610 Subraracnoid hemorrhage, aneurysmal that is more severe induces more TNC, which may cause the subsequent development of both vasospasm and vasospasm-unrelated secondary brain injury, leading to ischemia.
25016707 Studied serum levels of Tn-C containing the FNIIIB (B+ Tn-C) or FNIIIC (C+ Tn-C) domain in heart failure patients. Analysis of Tn-C concentrations according to heart failure etiology revealed no significant differences.
24829055 The coated combination of TnC and TnR appeared to regulate neural differentiation signaling through integrin alpha7 and alpha9beta1 in bone marrow-derived human mesenchymal stem cells.
24823872 Circulating concentrations of Tn-C are higher in patients with a recent history of atherosclerotic stroke and may play an anti-inflammatory role by reducing pro-inflammatory cytokine release from atheroma.
24808173 Tenascin-C-derived peptide TNIIIA2 highly enhances cell survival and platelet-derived growth factor (PDGF)-dependent cell proliferation through potentiated and sustained activation of integrin alpha5beta1.
24792713 Data indicate the expression of fetal ED-A(+) fibronectin and B (+) tenascin-C splicing variants in cardiac tissue from heart transplant recipients.
24777587 Tn-C and Gl-3 are promising markers for the diagnosis of pulmonary sarcoidosis, but they are not specific for cardiac involvement.
24722824 although serum TNC levels are elevated, it has no predictive or prognostic roles on survival in epithelial ovarian cancer patients.
24696262 In conclusion, although serum TNC levels are elevated, it has no predictive or prognostic roles on survival in breast cancer patients.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of tenascin C (TNC) in primary human brain microvascular endothelial cells
24598996 Results found that Tenascin-C FNIIIA1 is over-expressed in osteosarcoma tissues and can promote MG-63 cell migration suggesting that high expression of A1 may promote metastasis of osteosarcoma.
24503185 Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression.
24145401 Tenascin-C is an innate broad-spectrum, HIV-1-neutralizing protein in breast milk.
24145401 Microarray analysis indicates HIV-1 Tat-induced upregulation of tenascin C (TNC) in primary human brain microvascular endothelial cells
24063281 Taken together,these findings suggest that growth factors and mechanical strain can induce TN-C in osteosarcoma through different pathways additively.
23998545 Serum levels of MMP-9, TIMP-1 and B(+) Tn-C and tissue levels of B(+) Tn-C and ED-A(+) Fn are promising markers for risk assessment in dilated cardiomyopathy.
23963648 The study shows that Tenascin-C is expressed by human glioma in vivo and shows a strong association with tumor blood vessels.
23936043 Exome sequencing and linkage analysis identified tenascin-C (TNC) as a novel causative gene in nonsyndromic hearing loss.
23882691 TNC does not appear to contribute directly to outflow resistance in the eye.
23834524 serum levels elevated in scleroderma
23742930 Serum levels of tenascin-C are elevated in type B acute aortic dissection.
23708783 Tenascin-C expression in esophageal squamous carcinoma cells may in part explain why C4.4A is associated with a poor prognosis of esophageal squamous carcinoma since TNC can promote invasion and metastasis.
23656926 Tenascin-C is a marker of progressive destabilization of the aortic wall independent of size in chronic dilatation and acute dissection.
23645740 High tenascin-C expression is associated with colorectal cancer.
23637968 The promiscuous yet high affinity of TNC for a wide array of growth factors, mediated mainly by TNCIII5, may play a role in multiple physiological and pathological processes involving TNC.
23532307 Demonstrate that tenascin-C level is associated with pathologic conditions in acute coronary syndrome, especially the presence of ruptured plaque.
23485472 The interaction of TNC with immobilized FN was attenuated, the scratch wound closure by keratinocytes was delayed and the inhibition of cell spreading on FN by TNC was recovered in the presence of SSL8.
23454256 IL-1alpha reduces CCN2 expression and increased TNC expression in human cardiac fibroblasts.
23280617 The interaction of aptamer GBI-10 with TN-C depended on the presence of Mg(2)+.
23269478 TnC and TnR play important roles in nervous and immune systems. [Review]
23192621 This study further implicates the genomic region containing the TNC and COL27A1 genes in influencing risk of Achilles tendinopathy, and maps the potential risk allele to a genetic interval flanked by rs946053 and rs2104772.
23064399 In view of its specific expression, TN-C could be a realistic and promising biomarker and a target for molecular imaging for the diagnosis of various cardiovascular diseases.
22951722 these findings suggest that melanoma-derived TNCEGFL exert a role in melanoma invasion by modulating ROCK signaling and cell migration.
22851489 TNC is involved in the etiopathology of obesity via visceral adipose tissue inflammation representing a link with extracellular matrix remodeling.
22760918 The present results demonstrated that the bronchoalveolar lavage fluid tenascin-C level was correlated with pulmonary infiltrates on chest radiographs in patients with sarcoidosis.
22699754 TNC produced by oxLDL-stimulated macrophages increases foam cell formation through TLR4 and scavenger receptor CD36.
22511780 Rationally engineered TnC constructs corrected the abnormal Ca(2+) sensitivities of the thin filament, reconstituted actomyosin ATPase activity
22495383 Dermal expression of tenascin-C in the vitiligenous lesion may be linked to the disease more than epidermal expression.
22110694 a soluble human TNFR2 agonist (TNC-scTNF(R2)) rescues human neurons from oxidative stress-induced cell death
22039306 we have identified alpha(9) integrin-mediated signaling by TN-C and OPN as a novel intrinsic regulator of pathogenic Th17 cell generation that contributes to the development of rheumatoid arthritis.
21997179 High tenascin-C is associated with the invasive phenotype of low-grade astrocytoma.
21951663 TN-C may be a useful biomarker for indicating the pathological status of smooth muscle cells and interstitial cells in abdominal aortic aneurysm.
21885141 Increased expression of tenascin-C was observed in sites of epithelial-mesenchymal interaction and loss of cell-cell adhesion was assessed in translocated epithelial cells in the stroma.
21862932 TNC in the cerebrospinal fluid may be a useful biomarker for predicting subsequent development of cerebral vasospasm
21839747 Kinetic partitioning mechanism governs the folding of the third FnIII domain of tenascin-C.
21763295 Progression of urothelial carcinoma of the urinary bladder with time is accompanied by significant changes in urinary levels of B(+) Tn-C
21762512 TN-C expression in knee cartilage and TN-C levels in synovial fluid are both enhanced in osteoarthritis patients. Elevated levels of TN-C induce inflammatory mediators and promote matrix degradation in osteoarthritic joints.
21559807 Tenascin-C is likely involved in the fibrosis that occurs around collecting ducts in chronic sclerosing sialadenitis
21512282 higher tenascin-C levels are related to the total occlusion and inflammation after myocardial infarction
21501293 Thrombin-cleaved forms of sOPN and TN-C share a common integrin receptor, alpha9beta1, and alpha9beta1 integrin-mediated signaling is involved in the pathogenesis of various autoimmune diseases.
21496259 Demonstrate increased expression of tenascin-C and alpha-smooth muscle actin positive cells in the large airways in chronic obstructive pulmonary disease.
21403679 NB tumors two putative niches containing Oct-4(+) tumor cells. Oct-4(+)/TNC(+) perivascular NB cells displayed a high degree of plasticity and served as progenitors of TECs.
21350305 High Tenascin-C is associated with acute pulmonary thromboembolism.
21298289 SNP rs12347433 is a synonymous coding SNP and may be biologically relevant to the mechanism by which tenascin-C influences the pathophysiology of CAD and atherosclerosis
21281808 TNC could induce EMT-like change showing loss of intercellular adhesion and enhanced migration in breast cancer cells, associated with FAK phosphorylation by SRC
21183183 plasma large splice variant levels of tenascin-C are independently associated with cardiovascular outcomes in CKD patients.
21091771 Expression of tenascin-c and integrin beta3 decrease the expression of uPA through p38 MAPK in breast neolasms.
21039988 Type-II alveolar epithelial cells from three types of Idiopathic interstitial lung diseases express tenascin-C.
20729912 Tenascin-C promotes melanoma progression by maintaining the ABCB5-positive side population.
20727496 The combination of an increased expression of the antimicrobial peptide DEFA-4, the oncogene S100-A7, epidermal growth factor, and tenascin-c, and a decreased Doc-1 expression in oral leukoplakia might characterize its potency of malignant transformation.
20708078 Tenascin-C contains cryptic sites which can control tissue levels of fibrillar fibronectin either by preventing de novo fibril assembly or reducing levels of deposited fibronectin.
20678196 Data suggest a highly significant association between AD-containing TNC isoforms and breast cancers in younger women (age </=40 years), which may have important functional significance in vivo.
20653781 Differential gene expression in classic giant cell tumours of bone: Tenascin C as biological risk factor for local relapses and metastases.
20651280 Study provides evidence that TN-C serves as a novel adhesive matrix for platelets in a context that is relevant to atherothrombosis.
20622113 Glioblastoma cells can actively paralyze T cell migration by the expression of tenascin-C, representing a novel immune suppressive mechanism achieved through tumor extracellular matrix.
20613589 Microarray analysis showed that TNC was highly expressed in early osteogenesis.
20583170 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20232238 An increased expression of fibronectin and tenascin-C mRNA in association to histological damage and in valvular heart disease compared to coronary artery disease could be shown.
20107185 Data show that the expression of tenascin-C is induced in immune myeloid cells, and its synthesis is transcriptionally regulated and requires the specific activation of AKT/PI3K and NF-kappaB signaling pathways.
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20042668 TN-C increased epithelial c-met expression and promoted luminal filling in mammary gland.
19944367 Elevated serum tenascin-C levels is a predictor of left ventricular and pulmonary vascular remodeling in dilated cardiomyopathy patients.
19887451 Here we show that periostin, a matricellular protein, promotes incorporation of tenascin-C into the extracellular matrix and organizes a meshwork architecture of the extracellular matrix.
19748582 data indicate that, at least under pathological conditions, meprinbeta might attack specific functional sites in tenascin-C that are important for its oligomerization and anti-adhesive activity
19721293 Tenascin-C is responsible for the pathogenesis of idiopathic interstitial pneumonia, especially via inflammation, and it might serve as a serum marker of cryptogenic organizing pneumonia.
19688689 An immunohistochemical study on TNC expression in total Achilles tendon rupture was performed.
19589197 In a clinical study of cerebral vasospasm, serum TN-C levels increase transiently, the extent being significantly greater in patients with subsequent vasospasm.
19581738 Ressutls show that cystic tumors of the pancreas express syndecan-1 and tenascin differently and suggest that low syndecan-1 expression might serve as a predictive factor for malignancy.
19561617 tenascin-C as a novel endogenous activator of TLR4-mediated immunity that mediates persistent synovial inflammation and tissue destruction in arthritic joint disease.
19484261 Stromal Tenascin-C expression seems to be an indicator of a further step in carcinogenesis of medullary thyroid carcinoma irrespective of a RET oncogene germ-line mutation.
19459858 Endogenous TNC enhances glioblastoma invasion with reactive change of surrounding brain tissue.
19405959 Tumour-associated tenascin-C isoforms promote breast cancer cell invasion and growth by matrix metalloproteinase-dependent and independent mechanisms.
19326143 Increase in urinary concentrations of both Tn-C B and C domain is associated with urinary bladder tumour progression.
19287959 Tn-C deposition into the extracellular matrix requires participation of active MMP-2 and stromal fibroblasts
19147558 In gliomas, the TNC gene is transactivated by Notch2 in an RBPJk-dependent manner mediated by an RBPJk binding element in the TNC promoter.
19070467 Tenascin C is a tumor marker for disease progression in sentinel lymph nodes of melanoma patients.
18815154 Observational study of gene-disease association. (HuGE Navigator)
18794852 tumor-cell expressions of alpha9 and beta1 integrins in combination with extracellular tenascin (tenascin C is preferential substrate) are necessary for medulloblastoma adhesion to the leptomeninges.
18757408 RNA microarray data reveal expression of tenascin-C, PDGFs, LPA, and the respective receptors in several types of cancer, suggesting that the TN/LPA/PDGF axis exists in malignant tumors
18751374 EMMPRIN regulates migration, MMP production by mouth cancer SCC cells and deposition of the TN-C matrix.
18695899 High tenascin-C expression is associated with metastasis in clear cell renal cell carcinoma.
18504437 Overexpression of tenascin-C is associated with breast tumor growth and lung metastasis
18502153 Report expression of tenascin-c and CD44 receptors in cardiac myxomas.
18353721 Observational study of gene-disease association. (HuGE Navigator)
18305139 In asthma and atopic sensitization significant gene-gene interactions were found between TNC and NPSR1 SNPs.
18305139 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18177748 We demonstrated that overexpression of GATA-6 in fibroblasts inhibited basal levels, as well as markedly decreased IL-4- and TGF-beta-induced TN-C mRNA and protein levels.
18173448 The combination of hypoxia and interleukin-1beta caused a significant increase in tenascin-C protein and mRNA of synovial fibroblasts. Tenascin-C is significantly detected in both the synovial tissue and disks in ID of TMJ.
18062933 Ecto-5'-nucleotidase is a novel and specific receptor for tenascin C
18061975 TNF-alpha stimulated tenascin-C expression through NF-kappaB signaling with RelA activation in cultured OA chondrocytes, suggesting involvement of tenascin-C in OA cartilage remodeling.
17983425 low-grade astrocytomas exhibit variations in TN-C expression with site, and this expression is associated with an independent prognostic value in terms of recurrence
17901052 analysis of how a peptide derived from tenascin-C induces beta1 integrin activation through syndecan-4
17681310 The modulation of tenascin as an extracellular matrix protein by estradiol in endometriotic stromal cells may be one of the factors playing a role in the development of endometriosis.
17616673 Endothelin receptor type B counteracts tenascin-C-induced endothelin receptor type A-dependent focal adhesion and actin stress fiber disorganization
17584833 An increase in tenascin C expression in the midbelly of the skeletal muscle in both legs provides further evidence of a potential role for the extracellular matrix in the phenomenon of delayed onset of muscle soreness.
17311283 TNC repeat Ten14 in monomeric form does not bind EGFR with sufficient stability so as to induce degradation of receptor, or undergo EGFR-mediated internalization over either the short (20 min) or long (48 h) term
17202312 TNXB and TNC may be involved in the malignant transformation of plexiform neurofibromas
17188391 TN-C and its variants are produced by hepatic stellate cells/myofibroblasts, suggesting important roles in liver fibrogenesis.
17188181 Plasma large Tenascin-C spliced variant as a possible biomarker for the prediction of hepatic recurrence in colorectal cancer.
17181107 TGF-beta1 and eosinophils dramatically induced Tn-C mRNA and protein expression in nasal epithelial cells.
17083689 Tenascin expression in AKs is related to the stages of dysplasia. Tenascin plays a role in neoplastic progression working as an anti-adhesive factor.
17013087 tenascin production of fibroblasts in the tumour stroma is directly modulated by melanoma cells mainly through cell-to-cell contact signalling
16996565 Tenascin-C expressed around granulomas in sarcoidosis, atypical mycobacteriosis, and tuberculosis of the lung and colocalized with the expression of myofibroblasts.
16926030 endogenous expression of tenascin-C down-regulates cell contractility and exerts its effects via a Rho GTPase signaling pathway
16782755 Link between BMPR2 mutations and induction of Prx 1-dependent tenascin-c gene transcription in familial pulmonary hypertension smooth muscle cells.
16493581 although the exact interaction between tenascin-C and PG-M/versican remains not entirely clear, these two molecules appear to play significant roles in the pathological mechanisms of idiopathic carpal tunnel syndrome
16461331 The role of tenascin-C as a microenvironmental regulator of cardiac endothelial/EPC activity is reported.
16388320 results indicate that TN-C plays a role in angiogenesis and tumor cell proliferation in glioblastoma
16292494 Tenascin-C and TGF-beta1 were expressed in the majority of high-grade gliomas. Induction of Tenascin-C by TGF-beta1 may be a possibe mechanism for invasion of high-grade gliomas.
16259977 Tn-C re-expression has been observed in papillary and medullary thyroid carcinomas with different staining patterns accompanied by the prevalence of different mRNA splice variants in cell cultures.
16245312 These results suggest that the upregulation of TN-C expression by PDGF involves Ets family transcription factors, co-operating with Sp1.
16157221 TnC-mediated adhesion can promote cell survival through Akt in human chondrosarcoma cells
16144346 Up-regulated expression of TNC in nasal polyp tissues is related to eosinophil-derived TGF-beta1.
16115819 Observational study of gene-disease association. (HuGE Navigator)
16115819 Leu1677Ile is valuable marker for evaluating the risk for developing asthma and plays a role in its pathogenesis.
16100012 Tenascin C, a gene induced by TGF-beta, is markedly increased in mouse lung during acute lung injury
16091738 Tenascin-C is a beta-catenin target gene in human colorectal tumors.
15983124 Observational study of gene-disease association. (HuGE Navigator)
15983124 Persons who have variants of the tenascin-C gene with 12 and 14 guanine-thymine repeats appear to have a 6-fold risk of developing Achilles tendon injuries.
15892123 Astrocytes grown on TN-C revert to a quiescent, nonactivated state that is partially reversible. This raises the possibility that therapeutic strategies aimed at manipulating TN-C levels during CNS injury may help reduce astrocytic scarring.
15844597 The expression of Tenascin-C mRNA is markedly enhanced in keloids.
15816617 Tn-C may play an important role in angiogenesis of patients with non-small cell lung cancer
15558324 TNC expression can be studied on reconstructed skin on nude mice.
15530854 modulation of cell shape, focal adhesion formation, and actin stress fiber organization by TNC, thereby modulating chondrocyte differentiation
15511229 kinetics and thermodynamics drive the correct pairing of cysteines in epidermal growth factor-like repeats of human tenascin
15469480 In primary melanoma of the skin, absence of Tn-C in the stroma of invasion fronts and within tumour cells seems to be related to a more benign disease behaviour with a lower risk of developing metastases.
15455729 different distributions of tenascin-C and -X were found around the epithelium and the endomysium of the mental symphyseal region, and affect the specific formation of the mandible during ossification in the fetus
15239346 tenascin-C expression may be a potential prognostic marker in colorectal carcinoma
15178565 Tn-C upregulates matrix metalloprotease expression that cleaves Tn-C into fragments containing the EGF-like domain. This domain has proapoptotic activity for smooth muscle cells.
15073129 versican and tenascin have roles in preventing relapse of node-negative breast cancer
15059978 two convergent proinvasive agents secreted by myofibroblasts, namely hepatocyte growth factor and the TGF-beta-upregulated extracellular matrix glycoprotein tenascin-C, are each necessary though not sufficient for neoplasm invasion
15024713 TNC has a role in tissue remodeling after myocardial injury (review)
15001984 a novel, functional binding element in the proximal region of the TN-C promoter mediating responsiveness to TGF-beta involving Smad3/4, Sp1, Ets1, and CBP/p300
14981900 Tenascin is detectable in inflammatory vulvar disease, preinvasive and invasive vulvar lesions, but not in normal vulvar tissue and might therefore be a tumor marker.
14618612 These results clearly indicated that the expressions of both TN-C and VEGF depend on the surrounding mesenchyme, and that the function of mesenchyme is regulated by its own mesenchymal TN-C.
12759243 Findings provide strong evidence that the FNIII alternatively spliced region of tenascin-C has important roles in tumor progression of breast cancer.
12557222 TNC expression is involved in invasive and malignant phenotype of several Ewing family tumors.
12388760 Data show that tenascin-C regulates cell responses to a fibrin-FN matrix through modulation of focal adhesion kinase (FAK) and RhoA activation.
12351514 differences in protein levels found in the vitreous body of patients with diabetic retinopathy
12209613 tenascin C in cervical neoplasms
12182416 The atypical and malignant meningiomas showed higher levels of tenascin expression than the typical meningiomas. The more sensitive messenger ribonucleic acid-based methods confirmed the finding. Tenascin expression was correlated with peritumoral edema
11948127 Results suggest that tenascin-C degradation is a reliable marker for recurrence potential of stage-1 NSCLC.
11920587 tenacin-c isoforms in gliomas support tumor cell proliferation and tumor cell migration
11850444 tenascin-C is highly expressed in the walls of alveoli and bronchioli in respiratory distress syndrome and bronchopulmonary dysplasia
11714809 The alternatively spliced fibronectin type III domains of tenascin-C (TnFnIII A-D) inhibit both early and late lymphocyte activation events including activation-induced TCR/CD8 down-modulation, cytokine production, and DNA synthesis.

AA Sequence

MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLES      1 - 70
ASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQC     71 - 140
TAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDG    141 - 210
FTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCN    211 - 280
KPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHAC    281 - 350
HTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVN    351 - 420
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDG    421 - 490
YTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKE    491 - 560
QRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCSEVSPPKDLV    561 - 630
VTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKK    631 - 700
SIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQ    701 - 770
TGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIK    771 - 840
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLRRVSQTDNSIT    841 - 910
LEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKEDKESNPATIN    911 - 980
AATELDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYSLPTGQWVGVQLPRNTTSYVLRGLEPGQEYN    981 - 1050
VLLTAEKGRHKSKPARVKASTEQAPELENLTVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAARNL   1051 - 1120
TVPGSLRAVDIPGLKAATPYTVSIYGVIQGYRTPVLSAEASTGETPNLGEVVVAEVGWDALKLNWTAPEG   1121 - 1190
AYEYFFIQVQEADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG   1191 - 1260
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSMEIPGLRAGTPYTVTLHGEV   1261 - 1330
RGHSTRPLAVEVVTEDLPQLGDLAVSEVGWDGLRLNWTAADNAYEHFVIQVQEVNKVEAAQNLTLPGSLR   1331 - 1400
AVDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPEIGNLNVSDITPESFNLSWMATDGIFETFTI   1401 - 1470
EIIDSNRLLETVEYNISGAERTAHISGLPPSTDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDI   1471 - 1540
NPYGFTVSWMASENAFDSFLVTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKP   1541 - 1610
LRAEIVTEAEPEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL   1611 - 1680
REATEYEIELYGISKGRRSQTVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESFRITYVPITGG   1681 - 1750
TPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQ   1751 - 1820
PAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSP   1821 - 1890
RDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNG   1891 - 1960
PLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRK   1961 - 2030
NGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK   2031 - 2100
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWF   2101 - 2170
HWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA                                          2171 - 2201
//

Text Mined References (204)

PMID Year Title
26731558 2016 Tenascin-C, a Prognostic Determinant of Esophageal Squamous Cell Carcinoma.
26652622 2015 The co-expression of MMP-9 and Tenascin-C is significantly associated with the progression and prognosis of pancreatic cancer.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25808872 2015 Tenascin-C Protects Cancer Stem-like Cells from Immune Surveillance by Arresting T-cell Activation.
25794567 2015 Gene and Protein Expression of Fibronectin and Tenascin-C in Lung Samples from COPD Patients.
25774061 2015 Tenascin-C Levels, A Toll-like Receptor 4 Ligand, in Enthesitis-related Arthritis Category of Juvenile Idiopathic Arthritis: A Cross-sectional and Longitudinal Study.
25646025 2015 ADAM-9 is a novel mediator of tenascin-C-stimulated invasiveness of brain tumor-initiating cells.
25609695 2015 Global Oct4 target gene analysis reveals novel downstream PTEN and TNC genes required for drug-resistance and metastasis in lung cancer.
25567561 2016 Tenascin C levels in patients with mild and severe preeclampsia.
25515583 2014 Targeting the fibronectin type III repeats in tenascin-C inhibits epithelial-mesenchymal transition in the context of posterior capsular opacification.
25469866 2015 Tenascin-C: a novel candidate marker for cancer stem cells in glioblastoma identified by tissue microarrays.
25448067 2014 Tenascin C promotes hematoendothelial development and T lymphoid commitment from human pluripotent stem cells in chemically defined conditions.
25366610 2015 Tenascin-C is a possible mediator between initial brain injury and vasospasm-related and -unrelated delayed cerebral ischemia after aneurysmal subarachnoid hemorrhage.
25016707 2014 Serum levels of tenascin-C variants in congestive heart failure patients: comparative analysis of ischemic, dilated, and hypertensive cardiomyopathy.
24829055 2014 Different forms of tenascin-C with tenascin-R regulate neural differentiation in bone marrow-derived human mesenchymal stem cells.
24823872 Tenascin-C is increased in atherothrombotic stroke patients and has an anti-inflammatory effect in the human carotid artery.
24808173 2014 Tenascin-C-derived peptide TNIIIA2 highly enhances cell survival and platelet-derived growth factor (PDGF)-dependent cell proliferation through potentiated and sustained activation of integrin ?5?1.
24792713 2014 De novo expression of fetal ED-A(+) fibronectin and B (+) tenascin-C splicing variants in human cardiac allografts: potential impact for targeted therapy of rejection.
24777587 2014 Diagnostic value of strain echocardiography, galectin-3, and tenascin-C levels for the identification of patients with pulmonary and cardiac sarcoidosis.
24722824 2014 Clinical significance of serum tenascin-c levels in epithelial ovarian cancer.
24696262 2014 Clinical significance of serum tenascin-C levels in breast cancer.
24598996 2014 mTOR signal transduction pathways contribute to TN-C FNIII A1 overexpression by mechanical stress in osteosarcoma cells.
24503185 2014 Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145401 2013 Tenascin-C is an innate broad-spectrum, HIV-1-neutralizing protein in breast milk.
24063281 2013 Mechanical strain and growth factors regulate expression of tenascin-C by OS cells additively.
23998545 2013 Matrix metalloproteinase-9, tissue inhibitor of metalloproteinase-1, B? tenascin-C and ED-A? fibronectin in dilated cardiomyopathy: potential impact on disease progression and patients' prognosis.
23963648 2013 Tenascin-C is expressed by human glioma in vivo and shows a strong association with tumor blood vessels.
23936043 2013 Exome sequencing and linkage analysis identified tenascin-C (TNC) as a novel causative gene in nonsyndromic hearing loss.
23882691 2013 The effects of tenascin C knockdown on trabecular meshwork outflow resistance.
23834524 2013 Serum levels of tenascin-C in collagen diseases.
23742930 2013 Preliminary study of serum tenascin-C levels as a diagnostic or prognostic biomarker of type B acute aortic dissection.
23708783 2013 Concurrent expression of C4.4A and Tenascin-C in tumor cells relates to poor prognosis of esophageal squamous cell carcinoma.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23656926 2013 Type A dissection and chronic dilatation: tenascin-C as a key factor in destabilization of the aortic wall.
23645740 2013 Tumor-derived tenascin-C promotes the epithelial-mesenchymal transition in colorectal cancer cells.
23637968 2013 Tenascin C promiscuously binds growth factors via its fifth fibronectin type III-like domain.
23532307 2014 Serum tenascin-C level is associated with coronary plaque rupture in patients with acute coronary syndrome.
23485472 2013 Staphylococcal superantigen-like protein 8 (SSL8) binds to tenascin C and inhibits tenascin C-fibronectin interaction and cell motility of keratinocytes.
23454256 2013 Interleukin-1 has opposing effects on connective tissue growth factor and tenascin-C expression in human cardiac fibroblasts.
23280617 2013 Molecular recognition force spectroscopy study of the dynamic interaction between aptamer GBI-10 and extracellular matrix protein tenascin-C on human glioblastoma cell.
23269478 2013 Tenascins and inflammation in disorders of the nervous system.
23192621 2013 Investigation of variants within the COL27A1 and TNC genes and Achilles tendinopathy in two populations.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23064399 2012 Tenascin-C in cardiovascular tissue remodeling: from development to inflammation and repair.
22951722 2013 Melanoma cell invasiveness is promoted at least in part by the epidermal growth factor-like repeats of tenascin-C.
22851489 2012 Increased tenascin C and Toll-like receptor 4 levels in visceral adipose tissue as a link between inflammation and extracellular matrix remodeling in obesity.
22760918 2012 Elevated tenascin-C levels in bronchoalveolar lavage fluid of patients with sarcoidosis.
22699754 2012 Tenascin-C produced by oxidized LDL-stimulated macrophages increases foam cell formation through Toll-like receptor-4.
22511780 2012 Engineered troponin C constructs correct disease-related cardiac myofilament calcium sensitivity.
22495383 2012 Immunolocalization of tenascin-C in vitiligo.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
22110694 2011 A TNF receptor 2 selective agonist rescues human neurons from oxidative stress-induced cell death.
22039306 2011 ?9?1 integrin-mediated signaling serves as an intrinsic regulator of pathogenic Th17 cell generation.
21997179 2012 Brevican, neurocan, tenascin-C and versican are mainly responsible for the invasiveness of low-grade astrocytoma.
21951663 2011 Tenascin-C is expressed in abdominal aortic aneurysm tissue with an active degradation process.
21885141 2011 Expression of Wnt-1, TGF-? and related cell-cell adhesion components following radiotherapy in salivary glands of patients with manifested radiogenic xerostomia.
21862932 2011 Cerebrospinal fluid tenascin-C in cerebral vasospasm after aneurysmal subarachnoid hemorrhage.
21839747 2011 Kinetic partitioning mechanism governs the folding of the third FnIII domain of tenascin-C: evidence at the single-molecule level.
21763295 2011 B domain containing Tenascin-C: a new urine marker for surveillance of patients with urothelial carcinoma of the urinary bladder?
21762512 2011 Tenascin-C induces inflammatory mediators and matrix degradation in osteoarthritic cartilage.
21559807 2011 Tenascin-C in chronic sclerosing sialadenitis.
21512282 2011 The relationship between tenascin-C levels and the complexity of coronary lesion after myocardial infarction.
21501293 2011 Osteopontin, intrinsic tissue regulator of intractable inflammatory diseases.
21496259 2011 Tenascin-C and alpha-smooth muscle actin positive cells are increased in the large airways in patients with COPD.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21403679 2011 Oct-4+/Tenascin C+ neuroblastoma cells serve as progenitors of tumor-derived endothelial cells.
21350305 2011 Tenascin-C may be a predictor of acute pulmonary thromboembolism.
21298289 2011 Polymorphic variants in tenascin-C (TNC) are associated with atherosclerosis and coronary artery disease.
21281808 2011 Tenascin C induces epithelial-mesenchymal transition-like change accompanied by SRC activation and focal adhesion kinase phosphorylation in human breast cancer cells.
21269460 2011 Initial characterization of the human central proteome.
21183183 2011 High circulating levels of large splice variants of tenascin-C is associated with mortality and cardiovascular disease in chronic kidney disease patients.
21091771 2010 Integrin ?3 and its ligand regulate the expression of uPA through p38 MAPK in breast cancer.
21039988 2011 Oxidative damage and TGF-? differentially induce lung epithelial cell sonic hedgehog and tenascin-C expression: implications for the regulation of lung remodelling in idiopathic interstitial lung disease.
20729912 2010 Tenascin-C promotes melanoma progression by maintaining the ABCB5-positive side population.
20727496 2010 Gene expression of oncogenes, antimicrobial peptides, and cytokines in the development of oral leukoplakia.
20708078 2010 Cryptic domains of tenascin-C differentially control fibronectin fibrillogenesis.
20678196 2010 Association of invasion-promoting tenascin-C additional domains with breast cancers in young women.
20653781 2010 Differential gene expression in classic giant cell tumours of bone: Tenascin C as biological risk factor for local relapses and metastases.
20651280 2011 Novel function of tenascin-C, a matrix protein relevant to atherosclerosis, in platelet recruitment and activation under flow.
20622113 2010 Extracellular matrix of glioblastoma inhibits polarization and transmigration of T cells: the role of tenascin-C in immune suppression.
20613589 2010 Elucidating mechanisms of osteogenesis in human adipose-derived stromal cells via microarray analysis.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20232238 2010 Changes in extra cellular matrix remodelling and re-expression of fibronectin and tenascin-C splicing variants in human myocardial tissue of the right atrial auricle: implications for a targeted therapy of cardiovascular diseases using human SIP format antibodies.
20107185 2010 Transcriptional regulation of the endogenous danger signal tenascin-C: a novel autocrine loop in inflammation.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
20042668 2010 Quantitative analysis of three-dimensional human mammary epithelial tissue architecture reveals a role for tenascin-C in regulating c-met function.
19944367 2009 Incremental prognostic values of serum tenascin-C levels with blood B-type natriuretic peptide testing at discharge in patients with dilated cardiomyopathy and decompensated heart failure.
19887451 2010 Incorporation of tenascin-C into the extracellular matrix by periostin underlies an extracellular meshwork architecture.
19748582 2010 Specific processing of tenascin-C by the metalloprotease meprinbeta neutralizes its inhibition of cell spreading.
19721293 2009 Elevated levels of tenascin-C in patients with cryptogenic organizing pneumonia.
19688689 2009 Tenascin-C and type I and III collagen expression in total Achilles tendon rupture. An immunohistochemical study.
19589197 2010 Tenascin-C is induced in cerebral vasospasm after subarachnoid hemorrhage in rats and humans: a pilot study.
19581738 2009 Syndecan-1 and tenascin expression in cystic tumors of the pancreas.
19561617 2009 Tenascin-C is an endogenous activator of Toll-like receptor 4 that is essential for maintaining inflammation in arthritic joint disease.
19484261 2009 Tenascin C in medullary thyroid microcarcinoma and C-cell hyperplasia.
19459858 2009 Endogenous tenascin-C enhances glioblastoma invasion with reactive change of surrounding brain tissue.
19405959 2009 Tumour-associated tenascin-C isoforms promote breast cancer cell invasion and growth by matrix metalloproteinase-dependent and independent mechanisms.
19326143 2009 B and C domain containing tenascin-C: urinary markers for invasiveness of urothelial carcinoma of the urinary bladder?
19287959 2009 Role of fibrillar Tenascin-C in metastatic pancreatic cancer.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19147558 2009 Tenascin-C is a novel RBPJkappa-induced target gene for Notch signaling in gliomas.
19070467 2009 Tenascin C: a defensive role in sentinel lymph nodes of melanoma patients?
18815154 2008 Lack of association between Tenascin-C gene and spondyloarthritis.
18794852 2008 Integrins mediate adhesion of medulloblastoma cells to tenascin and activate pathways associated with survival and proliferation.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18757408 2008 Combined lysophosphatidic acid/platelet-derived growth factor signaling triggers glioma cell migration in a tenascin-C microenvironment.
18751374 EMMPRIN modulates migration and deposition of TN-C in oral squamous carcinoma.
18695899 2008 Prognostic significance of tenascin-C expression in clear cell renal cell carcinoma.
18504437 2008 Identification of VEGF-regulated genes associated with increased lung metastatic potential: functional involvement of tenascin-C in tumor growth and lung metastasis.
18502153 Expression of tenascin-c and CD44 receptors in cardiac myxomas.
18353721 2009 Investigation of the Sp1-binding site polymorphism within the COL1A1 gene in participants with Achilles tendon injuries and controls.
18305139 2008 Biological and genetic interaction between tenascin C and neuropeptide S receptor 1 in allergic diseases.
18177748 2008 GATA-6 is a novel transcriptional repressor of the human Tenascin-C gene expression in fibroblasts.
18173448 2008 Effect of hypoxia and interleukin-1beta on expression of tenascin-C in temporomandibular joint.
18062933 2008 Tenascin C interacts with ecto-5'-nucleotidase (eN) and regulates adenosine generation in cancer cells.
18061975 2008 Regulation of tenascin-C expression by tumor necrosis factor-alpha in cultured human osteoarthritis chondrocytes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17983425 2008 Tenascin-C expression relates to clinicopathological features in pilocytic and diffuse astrocytomas.
17901052 2007 A peptide derived from tenascin-C induces beta1 integrin activation through syndecan-4.
17681310 2008 Tenascin is highly expressed in endometriosis and its expression is upregulated by estrogen.
17616673 2007 Endothelin receptor type B counteracts tenascin-C-induced endothelin receptor type A-dependent focal adhesion and actin stress fiber disorganization.
17584833 2007 Myofibre damage in human skeletal muscle: effects of electrical stimulation versus voluntary contraction.
17311283 2007 Tenascin cytotactin epidermal growth factor-like repeat binds epidermal growth factor receptor with low affinity.
17202312 2007 Microarray-based identification of tenascin C and tenascin XB, genes possibly involved in tumorigenesis associated with neurofibromatosis type 1.
17188391 2007 Expression of large tenascin-C splice variants by hepatic stellate cells/myofibroblasts in chronic hepatitis C.
17188181 2007 Plasma large Tenascin-C spliced variant as a possible biomarker for the prediction of hepatic recurrence in colorectal cancer.
17181107 The up-regulated expression of tenascin C in human nasal polyp tissues is related to eosinophil-derived transforming growth factor beta1.
17083689 2006 Tenascin expression in actinic keratosis.
17013087 2006 Contact stimulation of fibroblasts for tenascin production by melanoma cells.
16996565 2007 Extracellular matrix proteins and myofibroblasts in granulomas of sarcoidosis, atypical mycobacteriosis, and tuberculosis of the lung.
16926030 2006 Adenoviral-mediated expression and local deposition of recombinant tenascin-C perturbs cell-dependent matrix contraction.
16891397 2006 Epithelial-derived TGF-beta2 modulates basal and wound-healing subepithelial matrix homeostasis.
16782755 2006 Tenascin-C is induced by mutated BMP type II receptors in familial forms of pulmonary arterial hypertension.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16493581 2006 Involvement of tenascin-C and PG-M/versican in flexor tenosynovial pathology of idiopathic carpal tunnel syndrome.
16461331 2006 Vascular tenascin-C regulates cardiac endothelial phenotype and neovascularization.
16388320 2005 Distribution pattern of tenascin-C in glioblastoma: correlation with angiogenesis and tumor cell proliferation.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16292494 2006 Tenascin-C protein is induced by transforming growth factor-beta1 but does not correlate with time to tumor progression in high-grade gliomas.
16259977 2006 Tenascin-C protein expression and mRNA splice variants in thyroid carcinoma.
16245312 2006 Platelet derived growth factor induced tenascin-C transcription is phosphoinositide 3-kinase/Akt-dependent and mediated by Ets family transcription factors.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
16157221 2005 Tenascin-C promotes cell survival by activation of Akt in human chondrosarcoma cell.
16144346 2005 [Relationship between the expression of tenascin C and TGF-beta1 in human nasal polyp tissues].
16115819 2005 Coding SNP in tenascin-C Fn-III-D domain associates with adult asthma.
16100012 2005 Gene expression changes during the development of acute lung injury: role of transforming growth factor beta.
16091738 2005 beta-Catenin regulates the expression of tenascin-C in human colorectal tumors.
15983124 2005 The guanine-thymine dinucleotide repeat polymorphism within the tenascin-C gene is associated with achilles tendon injuries.
15892123 2005 Tenascin C induces a quiescent phenotype in cultured adult human astrocytes.
15844597 2005 [The expression of tenascin-C mRNA in keloids and hypertrophic scars].
15816617 Serum tenascin-C as a potential predictive marker of angiogenesis in non-small cell lung cancer.
15558324 2005 Transplantation of reconstructed human skin on nude mice: a model system to study expression of human tenascin-X and elastic fiber components.
15530854 2004 Adhesion-mediated signal transduction in human articular chondrocytes: the influence of biomaterial chemistry and tenascin-C.
15511229 2004 Folding of epidermal growth factor-like repeats from human tenascin studied through a sequence frame-shift approach.
15469480 2004 Tenascin-C in primary malignant melanoma of the skin.
15455729 2004 Distribution of tenascin-C and -X, and soft X-ray analysis of the mandibular symphysis during mandible formation in the human fetus.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15239346 2004 Prognostic significance of matrix metalloproteinase-2, cathepsin D, and tenascin-C expression in colorectal carcinoma.
15178565 2004 EGF-Like domain of tenascin-C is proapoptotic for cultured smooth muscle cells.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15073129 2004 Expression of extracellular matrix components versican, chondroitin sulfate, tenascin, and hyaluronan, and their association with disease outcome in node-negative breast cancer.
15059978 2004 Tenascin-C and SF/HGF produced by myofibroblasts in vitro provide convergent pro-invasive signals to human colon cancer cells through RhoA and Rac.
15024713 2004 Interaction between cell and extracellular matrix in heart disease: multiple roles of tenascin-C in tissue remodeling.
15001984 2004 Tenascin-C upregulation by transforming growth factor-beta in human dermal fibroblasts involves Smad3, Sp1, and Ets1.
14981900 Tenascin in preinvasive lesions of the vulva and vulvar cancer.
14618612 2004 Tenascin-C regulates angiogenesis in tumor through the regulation of vascular endothelial growth factor expression.
12759243 2003 Involvement of large tenascin-C splice variants in breast cancer progression.
12557222 2003 Induction of tenascin-C by tumor-specific EWS-ETS fusion genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388760 2002 Tenascin-C modulates matrix contraction via focal adhesion kinase- and Rho-mediated signaling pathways.
12351514 2002 Tenascin-C levels in the vitreous of patients with proliferative diabetic retinopathy.
12209613 2002 Value of tenascin-C content and association with clinicopathological parameters in uterine cervical lesions.
12182416 2002 Tenascin in meningioma: expression is correlated with anaplasia, vascular endothelial growth factor expression, and peritumoral edema but not with tumor border shape.
12168675 2002 Tenascin-C expression and distribution in cultured human chondrocytes and chondrosarcoma cells.
11948127 2002 Degradation of tenascin-C and activity of matrix metalloproteinase-2 are associated with tumor recurrence in early stage non-small cell lung cancer.
11668187 2001 Increased expression of tenascin-C-binding epithelial integrins in human bullous keratopathy corneas.
11470832 2001 Epidermal growth factor (EGF)-like repeats of human tenascin-C as ligands for EGF receptor.
11313993 2001 Glial tumor cell adhesion is mediated by binding of the FNIII domain of receptor protein tyrosine phosphatase beta (RPTPbeta) to tenascin C.
10953015 2000 Tenascin-C suppresses Rho activation.
10103110 1999 The interaction between F3 immunoglobulin domains and protein tyrosine phosphatases zeta/beta triggers bidirectional signalling between neurons and glial cells.
9565552 1998 Identification of the ligand binding site for the integrin alpha9 beta1 in the third fibronectin type III repeat of tenascin-C.
9341124 1997 Mapping of a defined neurocan binding site to distinct domains of tenascin-C.
9314546 1997 Regulation of tenascin-C, a vascular smooth muscle cell survival factor that interacts with the alpha v beta 3 integrin to promote epidermal growth factor receptor phosphorylation and growth.
8824254 1996 Binding of the NG2 proteoglycan to type VI collagen and other extracellular matrix molecules.
8798654 1996 Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.
8769660 1996 Molecular mechanisms of cell and tissue interactions during early tooth development.
8548761 1996 Tenascin-C expression by angiogenic vessels in human astrocytomas and by human brain endothelial cells in vitro.
7680113 1993 A novel tenascin type III repeat is part of a complex of tenascin mRNA alternative splices.
7541634 1995 The integrin receptor alpha 8 beta 1 mediates interactions of embryonic chick motor and sensory neurons with tenascin-C.
7531707 1995 Human tenascin gene. Structure of the 5'-region, identification, and characterization of the transcription regulatory sequences.
7524681 1994 Analysis of aggrecan and tenascin gene expression in mouse skeletal tissues by northern and in situ hybridization using species specific cDNA probes.
7499434 1995 Binding of tenascin-C to soluble fibronectin and matrix fibrils.
2466295 1989 An alternatively spliced region of the human hexabrachion contains a repeat of potential N-glycosylation sites.
1719530 1991 Structure of the human hexabrachion (tenascin) gene.
1707164 1991 Human tenascin: primary structure, pre-mRNA splicing patterns and localization of the epitopes recognized by two monoclonal antibodies.
1704365 1991 The complete cDNA sequence of human hexabrachion (Tenascin). A multidomain protein containing unique epidermal growth factor repeats.
1385416 1992 Structure and chromosomal localization of the human gene for a brain form of prostaglandin D2 synthase.
1279805 1992 Structure of a fibronectin type III domain from tenascin phased by MAD analysis of the selenomethionyl protein.