Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.29
PubTator Score 6.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.261 4.9e-11
intraductal papillary-mucinous neoplasm ... 1.300 1.1e-02
ovarian cancer -2.600 7.6e-08

Gene RIF (4)

PMID Text
20485507 Haploinsufficiency for TMX3 results in a small eye phenotype and represents a novel genetic cause of microphthalmia and coloboma.
19240061 Observational study of gene-disease association. (HuGE Navigator)
17881353 analysis of TMX3 interdomain stabilization of the N-terminal redox-active domain
15623505 TMX3 is a thioredoxin-related transmembrane protein of the endoplasmic reticulum

AA Sequence

MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEM      1 - 70
KSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQ     71 - 140
QMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFV    141 - 210
YDEYEDGDLSSWINRERFQNYLAMDGFLLYELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDL    211 - 280
FHRDFQFGHMDGNDYINTLLMDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGD    281 - 350
SILQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQ    351 - 420
EQIEESKEQQEPSSGGSVVPTVQEPKDVLEKKKD                                        421 - 454
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23728934 2013 Polygenic transmission and complex neuro developmental network for attention deficit hyperactivity disorder: genome-wide association study of both common and rare variants.
21269460 2011 Initial characterization of the human central proteome.
20485507 2010 A male with unilateral microphthalmia reveals a role for TMX3 in eye development.
19995400 2010 Platelets release novel thiol isomerase enzymes which are recruited to the cell surface following activation.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17881353 2007 Structure-function analysis of the endoplasmic reticulum oxidoreductase TMX3 reveals interdomain stabilization of the N-terminal redox-active domain.
16381901 2006 The LIFEdb database in 2006.
15623505 2005 Identification and characterization of a novel thioredoxin-related transmembrane protein of the endoplasmic reticulum.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.