Property Summary

NCBI Gene PubMed Count 12
PubMed Score 270.79
PubTator Score 149.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Congestive heart failure 113 0.0 1.2
Schizophrenia 1160 0.0 0.9

Expression

  Differential Expression (31)

Disease log2 FC p
acute quadriplegic myopathy 1.143 8.3e-04
adult high grade glioma -1.500 1.8e-03
astrocytic glioma -1.800 3.3e-03
Astrocytoma, Pilocytic -1.900 1.6e-04
atypical teratoid / rhabdoid tumor -1.400 3.0e-02
Breast cancer -2.400 2.8e-02
breast carcinoma -1.300 6.5e-04
COPD 1.400 1.4e-02
cystic fibrosis 2.078 5.4e-06
ductal carcinoma in situ -1.500 1.8e-03
ependymoma -2.100 1.1e-02
glioblastoma -1.500 1.2e-03
group 3 medulloblastoma -1.100 3.4e-03
interstitial cystitis 1.100 9.2e-05
intraductal papillary-mucinous adenoma (... -2.200 2.7e-04
intraductal papillary-mucinous carcinoma... -2.400 3.2e-03
intraductal papillary-mucinous neoplasm ... -2.400 4.1e-03
invasive ductal carcinoma -2.000 1.6e-03
juvenile dermatomyositis 1.119 1.4e-08
lung adenocarcinoma -1.500 1.9e-09
medulloblastoma, large-cell -3.200 1.9e-04
non-small cell lung carcinoma -1.300 2.0e-12
oligodendroglioma -2.200 2.2e-02
osteosarcoma 1.229 1.6e-02
ovarian cancer 1.800 1.0e-04
Pick disease 1.500 1.3e-04
psoriasis -1.500 4.0e-10
Rheumatoid arthritis 1.800 4.4e-02
subependymal giant cell astrocytoma 1.347 1.6e-02
tuberculosis 1.500 9.2e-03
ulcerative colitis 1.700 1.2e-06

Gene RIF (6)

AA Sequence

MVVTTSARGGGGDRTPSRRRGCGLAPAGAAALLAGASCLCYGRSLQGEFVHDDVWAIVNNPDVRPGAPLR      1 - 70
WGIFTNDFWGKGMAENTSHKSYRPLCVLTFKLNIFLTGMNPFYFHAVNIILHCLVTLVLMYTCDKTVFKN     71 - 140
RGLAFVTALLFAVHPIHTEAVAGIVGRADVLACLLFLLAFLSYNRSLDQGCVGGSFPSTVSPFFLLLSLF    141 - 210
LGTCAMLVKETGITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPHRENGKQQRFP    211 - 280
HKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMRFLTYSYLLAFNVWLLLAPVTLCYDWQVGSIPLVETIW    281 - 350
DMRNLATIFLAVVMALLSLHCLAAFKRLEHKEVLVGLLFLVFPFIPASNLFFRVGFVVAERVLYMPSMGY    351 - 420
CILFVHGLSKLCTWLNRCGATTLIVSTVLLLLLFSWKTVKQNEIWLSRESLFRSGVQTLPHNAKVHYNYA    421 - 490
NFLKDQGRNKEAIYHYRTALKLYPRHASALNNLGTLTRDTAEAKMYYQRALQLHPQHNRALFNLGNLLKS    491 - 560
QEKKEEAITLLKDSIKYGPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLVDTG    561 - 630
LPEKAVAHYQQAIKLSPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQVAHKAEILSPLGALYYNTGRYE    631 - 700
EALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEKMTNHIVSEETGCLECYRLLSAIYSKQENHDKA    701 - 770
LDAIDKALQLKPKDPKVISELFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYV    771 - 840
SARAYYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT                                841 - 882
//

Text Mined References (14)

PMID Year Title