Property Summary

NCBI Gene PubMed Count 12
PubMed Score 244.80
PubTator Score 149.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Schizophrenia 503
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Congestive heart failure 36 0.0 1.0

Expression

  Differential Expression (31)

Disease log2 FC p
Rheumatoid Arthritis 1.800 4.4e-02
astrocytic glioma -1.800 3.3e-03
posterior fossa group A ependymoma -2.500 3.2e-08
oligodendroglioma -2.200 2.2e-02
glioblastoma -1.500 1.2e-03
osteosarcoma 3.361 7.6e-04
group 4 medulloblastoma -3.600 7.8e-08
cystic fibrosis 2.078 5.4e-06
atypical teratoid / rhabdoid tumor -1.400 3.0e-02
medulloblastoma, large-cell -3.200 1.9e-04
juvenile dermatomyositis 1.119 1.4e-08
acute quadriplegic myopathy 1.370 8.7e-05
tuberculosis 1.500 9.2e-03
intraductal papillary-mucinous adenoma (... -2.200 2.7e-04
intraductal papillary-mucinous carcinoma... -2.400 3.2e-03
intraductal papillary-mucinous neoplasm ... -2.400 4.1e-03
breast carcinoma -1.800 7.9e-27
Breast cancer -2.700 1.0e-09
interstitial cystitis 1.100 9.2e-05
lung adenocarcinoma -1.500 1.9e-09
adult high grade glioma -1.500 1.8e-03
pilocytic astrocytoma -1.900 1.8e-04
subependymal giant cell astrocytoma 1.347 1.6e-02
psoriasis -1.500 4.0e-10
COPD 1.400 1.4e-02
non-small cell lung carcinoma -1.300 2.0e-12
Pick disease 1.500 1.3e-04
ductal carcinoma in situ -2.200 1.8e-04
invasive ductal carcinoma -3.100 1.2e-04
ulcerative colitis 1.700 1.2e-06
ovarian cancer 2.400 2.1e-04

Gene RIF (6)

PMID Text
24764305 findings provide an important link between aneuploidy and the stress pathways activated by Aurora B inhibition and also support the use of Aurora B inhibitors in combination therapy for treatment of cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of transmembrane and tetratricopeptide repeat containing 1 (TMTC1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MVVTTSARGGGGDRTPSRRRGCGLAPAGAAALLAGASCLCYGRSLQGEFVHDDVWAIVNNPDVRPGAPLR      1 - 70
WGIFTNDFWGKGMAENTSHKSYRPLCVLTFKLNIFLTGMNPFYFHAVNIILHCLVTLVLMYTCDKTVFKN     71 - 140
RGLAFVTALLFAVHPIHTEAVAGIVGRADVLACLLFLLAFLSYNRSLDQGCVGGSFPSTVSPFFLLLSLF    141 - 210
LGTCAMLVKETGITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPHRENGKQQRFP    211 - 280
HKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMRFLTYSYLLAFNVWLLLAPVTLCYDWQVGSIPLVETIW    281 - 350
DMRNLATIFLAVVMALLSLHCLAAFKRLEHKEVLVGLLFLVFPFIPASNLFFRVGFVVAERVLYMPSMGY    351 - 420
CILFVHGLSKLCTWLNRCGATTLIVSTVLLLLLFSWKTVKQNEIWLSRESLFRSGVQTLPHNAKVHYNYA    421 - 490
NFLKDQGRNKEAIYHYRTALKLYPRHASALNNLGTLTRDTAEAKMYYQRALQLHPQHNRALFNLGNLLKS    491 - 560
QEKKEEAITLLKDSIKYGPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLVDTG    561 - 630
LPEKAVAHYQQAIKLSPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQVAHKAEILSPLGALYYNTGRYE    631 - 700
EALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEKMTNHIVSEETGCLECYRLLSAIYSKQENHDKA    701 - 770
LDAIDKALQLKPKDPKVISELFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYV    771 - 840
SARAYYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT                                841 - 882
//

Text Mined References (14)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24764305 2014 TMTC1 and TMTC2 are novel endoplasmic reticulum tetratricopeptide repeat-containing adapter proteins involved in calcium homeostasis.
22885689 2012 Genome-wide association study of multiplex schizophrenia pedigrees.
22771904 2012 Characterizing the neurite outgrowth inhibitory effect of Mani.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.