Property Summary

NCBI Gene PubMed Count 37
PubMed Score 143.13
PubTator Score 21.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma -1.200 3.5e-02
oligodendroglioma -1.300 1.7e-02
Duchenne muscular dystrophy 1.624 9.9e-11
limb girdle muscular dystrophy 2A 1.256 5.8e-08
Becker muscular dystrophy 1.319 4.6e-05
juvenile dermatomyositis 1.524 8.8e-13
pancreatic ductal adenocarcinoma liver m... 2.613 6.6e-04
pancreatic cancer 1.800 1.7e-04
lung cancer -3.500 4.3e-02
diabetes mellitus -1.800 4.7e-03
lung carcinoma -1.500 4.3e-23
pituitary cancer -1.200 2.9e-05
dermatomyositis 1.100 1.9e-02

Gene RIF (20)

PMID Text
25037578 High expression of thymosin beta 10 is associated with hepatocellular carcinoma.
24974154 High expression levels of TMSB10 correlated with lymphatic metasttases in papillary thyroid carcinoma, especially in the central neck region.
24854554 Tbeta10 human recombinant proteins promoted the expression of VEGF-C by activating AKT phosphorylation in lung cancer cell lines.
24704991 Regarding HCC, Tbeta4 reactivity was detected in 7/23 cases (30%) and Tbeta10 reactivity in 22/23 (97%) cases analyzed, adding HCC to human cancers that express these beta-thymosins.
24053380 Low expression of Tbeta10 is associated with metastatic phenotype of CCA in vitro and in vivo.
22623951 Thymosin beta10 expression driven by the human TERT promoter induces ovarian cancer-specific apoptosis through ROS production.
22161024 Amplification of thymosin beta 10 is associated with metastatic and aggressive papillary thyroid carcinomas.
22038593 hypomethylation of the promoter is not associated with its overexpression in non-small cell lung cancer
21733645 The results show, for the first time, a strong expression of thymosin beta 10 in the human salivary glands during the initial phases of the physiological development, present at the 13th week of gestation, and suggesting a role for the peptide in the salivary glands' organogenesis.
21314931 Describe beta-thymosins in bronchoalveolar lavage fluid and their possible involvement in the pathogenesis of scleroderma lung disease.
20836742 The expression of Tbeta10 in the human kidney during the initial phases of its physiological development, mainly restricted in the proximal and the distal tubuli.
19337364 outlines for the first time that salivary glands during foetal life express and secrete peptides such as beta-thymosins probably involved in the development of the oral cavity and its annexes
19194824 Thymosin beta-10 is aberrantly expressed in pancreatic cancer and induces JNK activation.
18789485 Expression of TB10 and its role in non-small cell lung cancer are reported.
16786322 the distribution of staining for thymosin beta10 was inverse of staining for F-actin. These data support a physiological role for thymosin beta10 in sequestration of G-actin as well as in cancer cell motility.
16012174 results strongly suggest that Thr20 is specifically required for actin sequestration by TB10 in ovarian cancer cells
15665289 Inhibition of Ras signal transduction by thymosin beta(10) results in antiangiogenic and antitumor effects, suggesting that thymosin beta(10) may be valuable in anticancer therapy.
15254683 TB10 has a role in progression of human thyroid carcinomas, particularly in the anaplastic histotypes
14741341 Introduction of E-Tmod cDNA into a tumor cell line reverses TB10 mediated apoptosis and restored actin architectures.
12481941 TB10 plays a critical role in the regulation of anchorage-independent growth and assembly of actin filaments.

AA Sequence

MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS                                1 - 44
//

Text Mined References (45)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25037578 2014 High expression of thymosin beta 10 predicts poor prognosis for hepatocellular carcinoma after hepatectomy.
24974154 2014 Thymosin beta 10 correlates with lymph node metastases of papillary thyroid carcinoma.
24854554 2014 [Thymosin beta 10 prompted the VEGF-C expression in lung cancer cell].
24704991 2014 Thymosin beta 4 and thymosin beta 10 expression in hepatocellular carcinoma.
24053380 2013 Suppression of thymosin ?10 increases cell migration and metastasis of cholangiocarcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22623951 2012 Thymosin ?10 expression driven by the human TERT promoter induces ovarian cancer-specific apoptosis through ROS production.
22161024 2012 Amplification of thymosin beta 10 and AKAP13 genes in metastatic and aggressive papillary thyroid carcinomas.
22038593 2011 Hypomethylation of the thymosin ?(10) gene is not associated with its overexpression in non-small cell lung cancer.
21733645 2011 Thymosin beta 10 expression in developing human salivary glands.
21314931 2011 ?-Thymosins and interstitial lung disease: study of a scleroderma cohort with a one-year follow-up.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20836742 2010 Thymosin beta-10 expression in developing human kidney.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19337364 2009 Thymosin beta(4) and beta(10) levels in pre-term newborn oral cavity and foetal salivary glands evidence a switch of secretion during foetal development.
19194824 2009 Thymosin beta-10 is aberrantly expressed in pancreatic cancer and induces JNK activation.
18789485 2009 Expression of thymosin beta10 and its role in non-small cell lung cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16786322 2007 Localization of thymosin beta10 in breast cancer cells: relationship to actin cytoskeletal remodeling and cell motility.
16012174 2005 The identification of apoptosis-related residues in human thymosin beta-10 by mutational analysis and computational modeling.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15665289 2005 Thymosin {beta}(10) inhibits angiogenesis and tumor growth by interfering with Ras function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254683 2004 Thymosin beta-10 gene expression as a possible tool in diagnosis of thyroid neoplasias.
14741341 2004 The interaction between E-tropomodulin and thymosin beta-10 rescues tumor cells from thymosin beta-10 mediated apoptosis by restoring actin architecture.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12914774 2003 Inflammatory mediators expressed in human islets of Langerhans: implications for islet transplantation.
12481941 2002 Thymosin beta-10 protein synthesis suppression reduces the growth of human thyroid carcinoma cells in semisolid medium.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11527208 2001 Array analysis of the genes regulated during neuronal differentiation of human embryonal cells.
11472367 2001 Profiling of genes expressed in human monocytes and monocyte-derived dendritic cells using cDNA expression array.
10487837 1999 Thymosin beta-10 gene overexpression is a general event in human carcinogenesis.
8425765 1993 Thymosin beta-10 expression in melanoma cell lines and melanocytic lesions: a new progression marker for human cutaneous melanoma.
7821789 1994 Construction of a human full-length cDNA bank.
3365256 1988 Sequence of a human kidney cDNA clone encoding thymosin beta 10.
2169566 1990 Thymosin beta 10 levels in developing human brain and its regulation by retinoic acid in the HTB-10 neuroblastoma.
2071228 1991 Differential expression of thymosin genes in human tumors and in the developing human kidney.
1744129 1991 Cloning and characterization of a testis-specific thymosin beta 10 cDNA. Expression in post-meiotic male germ cells.
1627460 1992 Expression of thymosin beta-4 and related genes in developing human brain.
1582498 1992 Evidence for the extranuclear localization of thymosins in thymus.