Property Summary

NCBI Gene PubMed Count 37
PubMed Score 44.76
PubTator Score 39.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (27)

PMID Text
26722035 TMPRSS4 expression is associated with postoperative recurrence. In addition, the current survival curves demonstrated that TMPRSS4 expression is associated with statistically significant differences in survival among patients with lung adenocarcinoma.
26546046 suggesting that TMPRSS4 is associated with a cancer stem cells phenotype in patients' tumors
26190376 The increase of TMPRSS4 expression may be a key event for HCC progression and may be regarded as a potential prognostic marker for HCC.
25550850 In prostate cancer, high TMPRSS4 expression was significantly associated with advanced tumor stage and lymphatic metastasis.
25414083 TMPRSS4 is upregulated by silencing of TFPI-2 through aberrant DNA methylation and contributes to oncogenesis in non-small cell lung cancer.
25244400 TMPRSS4 is overexpressed in thyroid cancer and TMPRSS4-CREB signaling is needed to sustain thyroid cancer cell proliferation.
25203520 On the basis of this information and the structural characteristics of this druggable protease, we suggest that TMPRSS4 could be a novel potential therapeutic target in solid tumours.
24532432 increased TMPRSS4 expression was an independent predictor of poor prognosis for overall survival in gallbladder cancer. patients.
24434435 We have demonstrated for the first time a new molecular pathway that connects TMPRSS4 and integrin alpha5 through miR-205 to regulate cancer cell invasion and metastasis
24434139 TMPRSS4 directly converted inactive pro-uPA into the active form through its proteolytic activity. Conditioned medium from cells overexpressing TMPRSS4 showed that the active TMPRSS4 protease domain is released and is associated with the plasma membrane.
24335200 TMPRSS4 was associated with CRC stage and regulated the proliferation and self-renewal ability of colon cancer cells; TMRPSS4 was involved in the development and progression of CRC.
24299317 Our data suggest that TMPRSS4 positivity is associated with GC invasion and lymph node metastasis. We propose TMPRSS4 expression as an indicator of poor prognosis in GC patients
24132607 TMPRSS4 was an independent predictor of OS and DFS.
24072509 High expression of TMPRSS4 was significantly associated with advanced TNM stage.
24012692 High TMPRSS4 expression is associated with cervical squamous cell carcinoma.
23978400 TMPRSS4 induced the transcription of uPA gene through activating the transcription factors Sp1, Sp3, and AP-1 in a JNK-dependent manner and that the induction of uPA was required for TMPRSS4-mediated cancer cell invasion.
23957953 A mutation in the serine protease TMPRSS4 in a novel pediatric neurodegenerative disorder
23922976 Expression of TMPRSS4 in gastric cancer is significantly associated with lymph node and distant metastasis, high Erk1 expression, and poor prognosis.
23420063 TMPRSS4 expression is a putative biological marker for breast cancer and is an indicator of poor prognosis.
22944691 Progression and metastatic potential of several cancers is concordant with an increased expression of TMPRSS4.
22692880 results demonstrate overexpression of TMPRSS4 in non-small cell lung carcinoma at both the mRNA and protein levels. In addition, our findings suggest that expression of TMPRSS4 in the tumor microenvironment is regulated by hypoxia.
22067904 Kaplan-Meier curves demonstrated that high levels of TMPRSS4 were significantly associated (P=0.017) with reduced overall survival in the patients with SCC histology, whereas no correlation was found for the AC histology
21637307 Overexpression of TMPRSS4 has a critical role in radiation-induced long-term dissemination and metastasis of residual HCC by facilitating EMT.
20631123 RNAi-mediated knockdown of TMPRSS2 and TMPRSS4 in Caco-2 cells, which released fully infectious virus without trypsin treatment, markedly reduced the spread of influenza virus, demonstrating that these proteases were responsible for activation of HA.
20118200 TMPRSS4 expression was significantly higher in human colorectal cancer tissues from advanced stages than in that of early stage.
19158246 The authors provide evidence that TMPRSS2 and TMPRSS4 activate the 1918 HA by cleavage and therefore may promote viral spread in lung tissue.
17968309 TMPRSS4 plays a role in invasion, metastasis, migration and adhesion in cancer cells. TMPRSS4 may contribute to tumor cell invasion and metastasis by promoting an epithelial-mesenchymal transition(EMT) through the strong SIP1/ZEB2 induction.

AA Sequence

MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHF      1 - 70
IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETAC     71 - 140
RQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEE    141 - 210
ASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIE    211 - 280
FNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQV    281 - 350
IDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYT    351 - 420
KVSAYLNWIYNVWKAEL                                                         421 - 437
//

Text Mined References (38)

PMID Year Title
26722035 2016 TMPRSS4 Expression as a Marker of Recurrence in Patients with Lung Cancer.
26546046 2016 TMPRSS4 induces cancer stem cell-like properties in lung cancer cells and correlates with ALDH expression in NSCLC patients.
26190376 2015 TMPRSS4 facilitates epithelial-mesenchymal transition of hepatocellular carcinoma and is a predictive marker for poor prognosis of patients after curative resection.
25550850 2014 Clinical significance of TMPRSS4 in prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25414083 2015 Methylation-induced downregulation of TFPI-2 causes TMPRSS4 overexpression and contributes to oncogenesis in a subset of non-small-cell lung carcinoma.
25244400 2015 Transmembrane protease serine 4 promotes thyroid cancer proliferation via CREB phosphorylation.
25203520 2015 TMPRSS4: an emerging potential therapeutic target in cancer.
24532432 2014 Clinical implication of TMPRSS4 expression in human gallbladder cancer.
24434435 2014 TMPRSS4 regulates levels of integrin ?5 in NSCLC through miR-205 activity to promote metastasis.
24434139 2014 TMPRSS4 induces cancer cell invasion through pro-uPA processing.
24335200 2014 TMPRSS4 correlates with colorectal cancer pathological stage and regulates cell proliferation and self-renewal ability.
24299317 2014 Prognostic significance of TMPRSS4 in gastric cancer.
24132607 2013 Expression of TMPRSS4 in patients with salivary adenoid cystic carcinoma: correlation with clinicopathological features and prognosis.
24072509 2013 High expression level of TMPRSS4 predicts adverse outcomes of colorectal cancer patients.
24012692 2013 High TMPRSS4 expression is a predictor of poor prognosis in cervical squamous cell carcinoma.
23978400 2014 TMPRSS4 upregulates uPA gene expression through JNK signaling activation to induce cancer cell invasion.
23957953 2013 A mutation in the serine protease TMPRSS4 in a novel pediatric neurodegenerative disorder.
23922976 2013 The expression of TMPRSS4 and Erk1 correlates with metastasis and poor prognosis in Chinese patients with gastric cancer.
23420063 2013 Prognostic value of TMPRSS4 expression in patients with breast cancer.
22944691 2012 TMPRSS4 is a type II transmembrane serine protease involved in cancer and viral infections.
22692880 2012 Expression of TMPRSS4 in non-small cell lung cancer and its modulation by hypoxia.
22067904 2011 Overexpression of TMPRSS4 in non-small cell lung cancer is associated with poor prognosis in patients with squamous histology.
21637307 2011 Radiation enhances long-term metastasis potential of residual hepatocellular carcinoma in nude mice through TMPRSS4-induced epithelial-mesenchymal transition.
20631123 2010 TMPRSS2 and TMPRSS4 facilitate trypsin-independent spread of influenza virus in Caco-2 cells.
20118200 2010 TMPRSS4 induces invasion and epithelial-mesenchymal transition through upregulation of integrin alpha5 and its signaling pathways.
19158246 2009 Proteolytic activation of the 1918 influenza virus hemagglutinin.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17968309 2008 TMPRSS4 promotes invasion, migration and metastasis of human tumor cells by facilitating an epithelial-mesenchymal transition.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10825129 2000 A novel transmembrane serine protease (TMPRSS3) overexpressed in pancreatic cancer.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.