Property Summary

Ligand Count 4
NCBI Gene PubMed Count 160
PubMed Score 438.22
PubTator Score 388.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.100 1.6e-03
Breast cancer -1.400 4.5e-07
gastric carcinoma -1.900 4.0e-02
interstitial cystitis -2.400 2.5e-03
intraductal papillary-mucinous neoplasm ... 1.400 2.8e-03
lung adenocarcinoma -1.500 8.2e-07
lung cancer -2.800 4.5e-04
lung carcinoma -4.400 8.0e-49
medulloblastoma, large-cell 1.100 1.7e-04
nasopharyngeal carcinoma -1.300 5.4e-06
non-small cell lung cancer -1.439 4.4e-07
osteosarcoma 1.670 8.5e-08
ovarian cancer 1.700 2.2e-09
psoriasis -1.400 4.1e-22

Gene RIF (140)

AA Sequence

MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPK      1 - 70
SPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCP     71 - 140
GGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFM    141 - 210
KLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHV    211 - 280
CGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMK    281 - 350
LQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLI    351 - 420
TPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRA    421 - 490
DG                                                                        491 - 492
//

Text Mined References (163)

PMID Year Title