Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.79
PubTator Score 1.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.100 2.5e-03
ependymoma -2.600 8.5e-10
glioblastoma -2.600 4.6e-06
medulloblastoma -2.100 6.2e-06
cystic fibrosis 1.485 4.5e-06
atypical teratoid / rhabdoid tumor -3.800 5.3e-08
medulloblastoma, large-cell -3.300 4.7e-07
primitive neuroectodermal tumor -1.400 1.2e-03
Breast cancer 2.300 4.6e-02
pediatric high grade glioma -1.900 1.1e-05
subependymal giant cell astrocytoma -1.268 2.3e-02
lung carcinoma 1.600 5.2e-27
ductal carcinoma in situ -1.200 2.1e-03
invasive ductal carcinoma -1.500 2.1e-03
ovarian cancer -2.800 5.2e-11

Gene RIF (1)

PMID Text
15095301 levels of TM1, TM2 and TM3 are reduced in human transitional cell carcinoma cells, but significantly upregulated by inhibition of the mitogen-activated protein kinase-signaling pathway

AA Sequence

MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLL      1 - 70
MYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGV     71 - 140
HNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNI    141 - 210
PIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKE    211 - 280
NDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADR    281 - 350
R//

Text Mined References (8)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15095301 2004 Alterations in tropomyosin isoform expression in human transitional cell carcinoma of the urinary bladder.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10662549 2000 Sequencing, expression analysis, and mapping of three unique human tropomodulin genes and their mouse orthologs.