Property Summary

NCBI Gene PubMed Count 29
PubMed Score 71.12
PubTator Score 35.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -1.100 6.2e-06
psoriasis -1.600 2.8e-04
osteosarcoma -3.364 7.9e-05
group 3 medulloblastoma -2.400 8.1e-04
glioblastoma 1.500 1.8e-02
atypical teratoid / rhabdoid tumor -2.700 5.3e-14
medulloblastoma, large-cell -2.600 2.8e-06
primitive neuroectodermal tumor -2.000 5.4e-03
adrenocortical adenoma -1.140 1.1e-02
adrenocortical carcinoma -2.248 2.9e-05
non-small cell lung cancer -1.821 4.2e-36
intraductal papillary-mucinous adenoma (... -2.200 1.4e-04
intraductal papillary-mucinous carcinoma... -1.800 3.8e-04
intraductal papillary-mucinous neoplasm ... -1.700 9.8e-03
colon cancer -3.800 5.5e-08
lung cancer -3.000 6.3e-06
lung adenocarcinoma -1.700 1.2e-16
pilocytic astrocytoma 1.200 1.9e-04
aldosterone-producing adenoma -1.348 1.5e-02
ductal carcinoma in situ -1.200 2.0e-04
invasive ductal carcinoma -1.500 5.0e-04
ovarian cancer -2.500 1.0e-06
pituitary cancer -1.400 4.4e-03

Gene RIF (8)

PMID Text
26873245 The mutation reduced binding affinity for both Lmod2 and Tmod1. The effect of the K15N mutation on Tpm1.1 binding to Lmod2 and Tmod1 provides a molecular rationale for the development of familial dilated cardiomyopathies .
25398440 Study highlighted a novel TMOD1-mediated link between NF-kappaB activation and MMP13 induction, which accounts in part for the NF-kappaB-dependent malignant phenotype of TNBC.
25061212 The structures and biochemical analysis of structure-inspired mutants showed that one Tmod molecule interacts with three actin subunits at the pointed end, while also contacting two tropomyosin molecules on each side of the filament.
24922351 Tmod1 and Tmod3 showed somewhat different tropomyosin-binding site utilization.
16434395 study identifies several amino acid residues on Tmod-1 that are important for its interaction with TM5 (a nonmuscle TM isoform)
16297372 The N-terminal "KRK ring" may participate in balancing electrostatic force with hydrophobic interaction in dimerization of TM and its binding to E-Tmod.
15095301 levels of TM1, TM2 and TM3 are reduced in human transitional cell carcinoma cells, but significantly upregulated by inhibition of the mitogen-activated protein kinase-signaling pathway
11964245 Tropomyosin requires an intact N-terminal coiled coil to interact with this protein

AA Sequence

MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDH      1 - 70
LEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTL     71 - 140
MSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI    141 - 210
PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNT    211 - 280
SLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGP    281 - 350
IIPKCRSGV                                                                 351 - 359
//

Text Mined References (31)

PMID Year Title
26873245 2016 Localization of the binding interface between leiomodin-2 and ?-tropomyosin.
26370058 2015 How Leiomodin and Tropomodulin use a common fold for different actin assembly functions.
25398440 2015 Tropomodulin 1 expression driven by NF-?B enhances breast cancer growth.
25250574 2014 Leiomodin-3 dysfunction results in thin filament disorganization and nemaline myopathy.
25061212 2014 Mechanism of actin filament pointed-end capping by tropomodulin.
24922351 2014 Functional effects of mutations in the tropomyosin-binding sites of tropomodulin1 and tropomodulin3.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21269460 2011 Initial characterization of the human central proteome.
20350937 2010 The FOXE1 locus is a major genetic determinant for radiation-related thyroid carcinoma in Chernobyl.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
16434395 2006 Leucine 135 of tropomodulin-1 regulates its association with tropomyosin, its cellular localization, and the integrity of sarcomeres.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16297372 2005 Mapping the tropomyosin isoform 5 binding site on human erythrocyte tropomodulin: further insights into E-Tmod/TM5 interaction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15095301 2004 Alterations in tropomyosin isoform expression in human transitional cell carcinoma of the urinary bladder.
14741341 2004 The interaction between E-tropomodulin and thymosin beta-10 rescues tumor cells from thymosin beta-10 mediated apoptosis by restoring actin architecture.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11964245 2002 Tropomyosin requires an intact N-terminal coiled coil to interact with tropomodulin.
11054557 2000 Genomic organization of mouse and human erythrocyte tropomodulin genes encoding the pointed end capping protein for the actin filaments.
11016930 2001 The N-terminal end of nebulin interacts with tropomodulin at the pointed ends of the thin filaments.
10871039 2000 Tropomodulin-binding site mapped to residues 7-14 at the N-terminal heptad repeats of tropomyosin isoform 5.
9110174 1997 Large-scale concatenation cDNA sequencing.
8954802 1996 An EST and STS-based YAC contig map of human chromosome 9q22.3.
8661028 1996 Gene assignment, expression, and homology of human tropomodulin.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8262158 1993 Tropomodulin is highly concentrated at the postsynaptic domain of human and rat neuromuscular junctions.
8002995 1994 Erythrocyte tropomodulin binds to the N-terminus of hTM5, a tropomyosin isoform encoded by the gamma-tropomyosin gene.
7962203 1994 Immunolocalization of tropomodulin, tropomyosin and actin in spread human erythrocyte skeletons.
1370827 1992 Molecular cloning and characterization of human fetal liver tropomodulin. A tropomyosin-binding protein.