Property Summary

NCBI Gene PubMed Count 19
PubMed Score 195.30
PubTator Score 28.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
medulloblastoma, large-cell -1.100 9.9e-03
tuberculosis -1.400 2.0e-06
active Crohn's disease 1.378 2.3e-02
spina bifida -1.548 4.4e-02
Pick disease -1.200 5.2e-04
progressive supranuclear palsy -1.300 6.6e-03
ovarian cancer 1.100 1.6e-02

Protein-protein Interaction (10)

Gene RIF (5)

PMID Text
24478191 In patient with chronic granulomatous disease, a 5.8-kb, incomplete and partly exonized TMF1 transcript was identified in intron 1 of CYBB, in opposite orientation to the host gene.
23239882 COG complex interacts with two different Rabs in addition to each end of the golgin "TATA element modulatory factor" (TMF).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19330832 Overexpression of TMF/ARA160 downregulates proangiogenic genes and attenuates the progression of prostate cancer xenografts.
17698061 These observations suggest critical roles for TMF in two Rab6-dependent retrograde transport processes: one from endosomes to the Golgi and the other from the Golgi to the endoplasmic reticulum.

AA Sequence

MSWFNASQLSSFAKQALSQAQKSIDRVLDIQEEEPSIWAETIPYGEPGISSPVSGGWDTSTWGLKSNTEP      1 - 70
QSPPIASPKAITKPVRRTVVDESENFFSAFLSPTDVQTIQKSPVVSKPPAKSQRPEEEVKSSLHESLHIG     71 - 140
QSRTPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVSLKVSESVIDVKTTMESI    141 - 210
SNTSTQSLTAETKDIALEPKEQKHEDRQSNTPSPPVSTFSSGTSTTSDIEVLDHESVISESSASSRQETT    211 - 280
DSKSSLHLMQTSFQLLSASACPEYNRLDDFQKLTESCCSSDAFERIDSFSVQSLDSRSVSEINSDDELSG    281 - 350
KGYALVPIIVNSSTPKSKTVESAEGKSEEVNETLVIPTEEAEMEESGRSATPVNCEQPDILVSSTPINEG    351 - 420
QTVLDKVAEQCEPAESQPEALSEKEDVCKTVEFLNEKLEKREAQLLSLSKEKALLEEAFDNLKDEMFRVK    421 - 490
EESSSISSLKDEFTQRIAEAEKKVQLACKERDAAKKEIKNIKEELATRLNSSETADLLKEKDEQIRGLME    491 - 560
EGEKLSKQQLHNSNIIKKLRAKDKENENMVAKLNKKVKELEEELQHLKQVLDGKEEVEKQHRENIKKLNS    561 - 630
MVERQEKDLGRLQVDMDELEEKNRSIQAALDSAYKELTDLHKANAAKDSEAQEAALSREMKAKEELSAAL    631 - 700
EKAQEEARQQQETLAIQVGDLRLALQRTEQAAARKEDYLRHEIGELQQRLQEAENRNQELSQSVSSTTRP    701 - 770
LLRQIENLQATLGSQTSSWEKLEKNLSDRLGESQTLLAAAVERERAATEELLANKIQMSSMESQNSLLRQ    771 - 840
ENSRFQAQLESEKNRLCKLEDENNRYQVELENLKDEYVRTLEETRKEKTLLNSQLEMERMKVEQERKKAI    841 - 910
FTQETIKEKERKPFSVSSTPTMSRSSSISGVDMAGLQTSFLSQDESHDHSFGPMPISANGSNLYDAVRMG    911 - 980
AGSSIIENLQSQLKLREGEITHLQLEIGNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQ    981 - 1050
RYNTILQMYGEKAEEAEELRLDLEDVKNMYKTQIDELLRQSLS                              1051 - 1093
//

Text Mined References (31)

PMID Year Title
24478191 2014 Primary immunodeficiency caused by an exonized retroposed gene copy inserted in the CYBB gene.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23239882 2013 Molecular insights into vesicle tethering at the Golgi by the conserved oligomeric Golgi (COG) complex and the golgin TATA element modulatory factor (TMF).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19330832 2009 TMF/ARA160 downregulates proangiogenic genes and attenuates the progression of PC3 xenografts.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18305892 2008 Search for cellular partners of human papillomavirus type 16 E2 protein.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17698061 2007 Functional involvement of TMF/ARA160 in Rab6-dependent retrograde membrane traffic.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467733 2004 TMF/ARA160 is a BC-box-containing protein that mediates the degradation of Stat3.
15128430 2004 TMF is a golgin that binds Rab6 and influences Golgi morphology.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12165860 2002 Repression of androgen receptor mediated transcription by the ErbB-3 binding protein, Ebp1.
12044884 2002 A putative nuclear receptor coactivator (TMF/ARA160) associates with hbrm/hSNF2 alpha and BRG-1/hSNF2 beta and localizes in the Golgi apparatus.
10428808 1999 Isolation and characterization of ARA160 as the first androgen receptor N-terminal-associated coactivator in human prostate cells.
9742951 1998 Tyrosine phosphorylation of the TATA element modulatory factor by the FER nuclear tyrosine kinases.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1409643 1992 Cloning and chromosomal mapping of a human immunodeficiency virus 1 "TATA" element modulatory factor.