Property Summary

NCBI Gene PubMed Count 17
PubMed Score 16.21
PubTator Score 16.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Multiple myeloma 1.440 8.1e-03
malignant mesothelioma 1.300 7.8e-05
oligodendroglioma 1.500 1.1e-02
esophageal adenocarcinoma 2.300 1.8e-02
psoriasis -1.900 2.7e-05
osteosarcoma 3.951 5.8e-07
group 3 medulloblastoma 2.100 3.0e-05
atypical teratoid / rhabdoid tumor 1.900 2.5e-06
glioblastoma 1.800 3.2e-04
medulloblastoma, large-cell 3.900 6.2e-07
primitive neuroectodermal tumor 2.100 1.9e-04
primary pancreatic ductal adenocarcinoma -2.086 9.7e-03
intraductal papillary-mucinous adenoma (... -4.200 2.2e-04
intraductal papillary-mucinous carcinoma... -2.900 1.7e-03
intraductal papillary-mucinous neoplasm ... -3.300 7.4e-03
lung cancer 2.100 1.2e-02
colon cancer 1.600 4.8e-04
sarcoidosis -1.100 3.0e-02
pancreatic cancer -2.200 1.3e-02
Breast cancer 2.700 2.8e-02
interstitial cystitis -4.400 2.2e-06
pediatric high grade glioma 1.200 9.2e-04
invasive ductal carcinoma 2.400 2.0e-03
nasopharyngeal carcinoma 1.600 1.7e-04
breast carcinoma 1.100 1.4e-10
ductal carcinoma in situ 1.800 2.6e-02
pituitary cancer 1.300 2.0e-03

Gene RIF (9)

PMID Text
26002575 High expression of TMEM97 is associated with glioma.
24853233 The down-regulation of MAC30 expression efficiently inhibited the proliferation of gastric cancer cells. Furthermore, the mobility of gastric cancer cells was also inhibited by down-regulation of MAC30.
23254963 MAC30 may serve as a new molecular marker to predict the lymph node metastasis and prognosis of patients with epithelial ovarian cancer
23229099 Overexpression of MAC30 is associated with non-small-cell lung cancer.
22024687 As the tumor penetrated the wall of the colon/rectum, MAC30 mRNA expression notably increased in colorectal tumors with T3+T4 stage compared to tumors with T1+T2 stage.
21079401 expression of MAC30 in the cytoplasm markedly increased from normal oral epithelial cells to primary oral squamous cell carcinoma; MAC30 expression in primary tumors with lymph node metastasis exceeded levels in those without metastasis
18070364 The most up-regulated gene was TMEM97 which encodes a transmembrane protein of unknown function (MAC30).
17143516 MAC30 protein may play a role in development of colorectal cancer, and can be considered as a prognostic factor.
15375745 MAC30 mRNA and protein expression in normal and cancerous tissue samples of the esophagus, stomach, colon and pancreas

AA Sequence

MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFKSFL      1 - 70
FCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLFEDFSKASGFKGQRPETLHER     71 - 140
LTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK                                      141 - 176
//

Text Mined References (22)

PMID Year Title
27378690 2016 Reduction of TMEM97 increases NPC1 protein levels and restores cholesterol trafficking in Niemann-pick type C1 disease cells.
26002575 2015 RNA interference against TMEM97 inhibits cell proliferation, migration, and invasion in glioma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25566323 2014 TM6SF2 and MAC30, new enzyme homologs in sterol metabolism and common metabolic disease.
25080503 2014 Meta-analysis of genome-wide association studies identifies two loci associated with circulating osteoprotegerin levels.
24853233 2014 Down-regulated MAC30 expression inhibits proliferation and mobility of human gastric cancer cells.
23254963 2013 Elevated expression of MAC30 predicts lymph node metastasis and unfavorable prognosis in patients with epithelial ovarian cancer.
23229099 2013 Overexpression of MAC30 is associated with poor clinical outcome in human non-small-cell lung cancer.
22024687 2011 Significance of mRNA and protein expression of MAC30 in progression of colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
21079401 2010 Overexpression of MAC30 in the cytoplasm of oral squamous cell carcinoma predicts nodal metastasis and poor differentiation.
19583955 2009 Identification of cholesterol-regulating genes by targeted RNAi screening.
18070364 2007 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17143516 2007 Expression of MAC30 protein is related to survival and biological variables in primary and metastatic colorectal cancers.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375745 2004 Expression analysis of MAC30 in human pancreatic cancer and tumors of the gastrointestinal tract.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7694637 1993 Identification and characterization of genes differentially expressed in meningiomas.