Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.84
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.9e-06
medulloblastoma, large-cell 6234 3.8e-05
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 36 4.634 2.3
Azoospermia 89 3.605 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.785 1.9e-06
medulloblastoma, large-cell 1.100 3.8e-05

AA Sequence

MWRLALGGVFLAAAQACVFCRLPAHDLSGRLARLCSQMEARQKECGASPDFSAFALDEVSMNKVTEKTHR      1 - 70
VLRVMEIKEAVSSLPSYWSWLRKTKLPEYTREALCPPACRGSTTLYNCSTCKGTEVSCWPRKRCFPGSQD     71 - 140
LWEAKILLLSIFGAFLLLGVLSLLVESHHLQAKSGL                                      141 - 176
//

Text Mined References (5)

PMID Year Title
24391514 2014 A nonsense mutation in TMEM95 encoding a nondescript transmembrane protein causes idiopathic male subfertility in cattle.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.