Property Summary

NCBI Gene PubMed Count 1
PubMed Score 16.60
PubTator Score 1.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

AA Sequence

MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTLFFVALHHACNGPGLSVLCFMRHDILEYFS      1 - 70
VYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRIYHDRWGYGVYSGPIGTAILIIAAKWLQKMKEK     71 - 140
KGLYPDKSVYTQQIGPGLCFGALALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGSPGTPAK    141 - 210
LDCSTLCCACV                                                               211 - 221
//

Text Mined References (2)

PMID Year Title