Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.55
PubTator Score 9.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.020 1.7e-04
Astrocytoma, Pilocytic 1.400 4.1e-08
atypical teratoid / rhabdoid tumor 1.500 3.2e-06
Breast cancer 1.300 2.3e-11
ependymoma 1.100 8.0e-10
glioblastoma 1.200 1.1e-05
invasive ductal carcinoma 1.200 1.9e-03
pancreatic cancer -1.100 3.3e-03
pediatric high grade glioma 1.400 2.3e-06
primary pancreatic ductal adenocarcinoma -1.064 2.1e-02

Gene RIF (2)

AA Sequence

MGRAGTGTGGEAVAAVVAGPLLLLLLARPPPASAGYSGKSEVGLVSEHFSQAPQRLSFYSWYGSARLFRF      1 - 70
RVPPDAVLLRWLLQVSRESGAACTDAEITVHFRSGAPPVINPLGTSFPDDTAVQPSFQVGVPLSTTPRSN     71 - 140
ASVNVSHPAPGDWFVAAHLPPSSQKIELKGLAPTCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSY    141 - 210
LKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVLTCTGAPWPCRLLLPSPPWDRWLQV    211 - 280
TAESLVGPLGTVAFSAVAALTACRPRSVTIQPLLQSSQNQSFNASSGLLSPSPDHQDLGRSGRVDRSPFC    281 - 350
LTNYPVTREDMDVVSVHFQPLDRVSVRVCSDTPSVMRLRLNTGMDSGGSLTISLRANKTEMRNETVVVAC    351 - 420
VNAASPFLGFNTSLNCTTAFFQGYPLSLSAWSRRANLIIPYPETDNWYLSLQLMCPENAEDCEQAVVHVE    421 - 490
TTLYLVPCLNDCGPYGQCLLLRRHSYLYASCSCKAGWRGWSCTDNSTAQTVAQQRAATLLLTLSNLMFLA    491 - 560
PIAVSVRRFFLVEASVYAYTMFFSTFYHACDQPGEAVLCILSYDTLQYCDFLGSGAAIWVTILCMARLKT    561 - 630
VLKYVLFLLGTLVIAMSLQLDRRGMWNMLGPCLFAFVIMASMWAYRCGHRRQCYPTSWQRWAFYLLPGVS    631 - 700
MASVGIAIYTSMMTSDNYYYTHSIWHILLAGSAALLLPPPDQPAEPWACSQKFPCHYQICKNDREELYAV    701 - 770
T//

Text Mined References (14)

PMID Year Title