Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.3e-35
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 1.3e-35

AA Sequence

STYYVAQMLVALSAVESREPVEHYRLTKAN                                            211 - 240

Text Mined References (6)

PMID Year Title