Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.23
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -1.128 2.6e-05
inflammatory breast cancer -1.300 1.9e-03
osteosarcoma -1.100 8.9e-03
spina bifida -1.399 4.6e-02

AA Sequence

MAEGARARGPRGCRDRDGPAGGAGKMAAPRRGRGSSTVLSSVPLQMLFYLSGTYYALYFLATLLMITYKS      1 - 70
QVFSYPHRYLVLDLALLFLMGILEAVRLYLGTRGNLTEAERPLAASLALTAGTALLSAHFLLWQALVLWA     71 - 140
DWALSATLLALHGLEAVLQVVAIAAFTR                                              141 - 168
//

Text Mined References (4)

PMID Year Title