Property Summary

NCBI Gene PubMed Count 14
PubMed Score 91.10
PubTator Score 4.56

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.301 2.8e-07
non-small cell lung cancer 1.682 9.1e-15
interstitial cystitis -1.400 1.3e-04
psoriasis 1.200 8.2e-12
spina bifida -1.659 3.9e-02
ductal carcinoma in situ 1.600 6.6e-04
invasive ductal carcinoma 1.300 1.2e-02
ovarian cancer 1.100 1.4e-06

Pathway (1)

Protein-protein Interaction (1)

Gene RIF (2)

PMID Text
26237329 The study identified two proteins, TMEM79 and ACOXL, with potential to differentiate between benign and cancerous prostatic glands in tissue biopsies.
24084074 Tmem79/Matt is the matted mouse gene and is a predisposing gene for atopic dermatitis in human subjects.

AA Sequence

MTEQETLALLEVKRSDSPEKSSPQALVPNGRQPEGEGGAESPGAESLRVGSSAGSPTAIEGAEDGLDSTV      1 - 70
SEAATLPWGTGPQPSAPFPDPPGWRDIEPEPPESEPLTKLEELPEDDANLLPEKAARAFVPIDLQCIERQ     71 - 140
PQEDLIVRCEAGEGECRTFMPPRVTHPDPTERKWAEAVVRPPGCSCGGCGSCGDREWLRAVASVGAALIL    141 - 210
FPCLLYGAYAFLPFDVPRLPTMSSRLIYTLRCGVFATFPIVLGILVYGLSLLCFSALRPFGEPRREVEIH    211 - 280
RRYVAQSVQLFILYFFNLAVLSTYLPQDTLKLLPLLTGLFAVSRLIYWLTFAVGRSFRGFGYGLTFLPLL    281 - 350
SMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG                              351 - 394
//

Text Mined References (15)

PMID Year Title
26237329 2015 Analysis of the Human Prostate-Specific Proteome Defined by Transcriptomics and Antibody-Based Profiling Identifies TMEM79 and ACOXL as Two Putative, Diagnostic Markers in Prostate Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25131691 2014 Mechanisms of abnormal lamellar body secretion and the dysfunctional skin barrier in patients with atopic dermatitis.
24647736 2014 Multiple nonglycemic genomic loci are newly associated with blood level of glycated hemoglobin in East Asians.
24084074 2013 Tmem79/Matt is the matted mouse gene and is a predisposing gene for atopic dermatitis in human subjects.
24060273 2013 A homozygous nonsense mutation in the gene for Tmem79, a component for the lamellar granule secretory system, produces spontaneous eczema in an experimental model of atopic dermatitis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.