Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma 1.017 2.5e-02
diabetes mellitus 1.300 3.8e-03
group 3 medulloblastoma -1.500 2.2e-03
non-small cell lung cancer -1.614 5.2e-23
pituitary cancer 1.200 1.0e-04

Gene RIF (1)

AA Sequence

MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVENACFSSEEHE      1 - 70
THFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVDYGFVSALVFLVSGILLVVTA     71 - 140
YAIPREARVNPDTVTAREMERLEMYYARLGSHLDRCIIAGLGLLTVGGMLLSVLLMVSLCKGELYRRRTF    141 - 210
VPGKGSRKTYGSINLRMRQLNGDGGQALVENEVVQVSETSHTLQRS                            211 - 256
//

Text Mined References (5)

PMID Year Title