Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
sonic hedgehog group medulloblastoma -1.600 4.3e-05
adrenocortical carcinoma 1.017 2.5e-02
non-small cell lung cancer -1.614 5.2e-23
diabetes mellitus 1.300 3.8e-03
pituitary cancer 1.200 1.0e-04

Synonym

Accession Q9NUR3 D3DVW5
Symbols C20orf46

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20944657 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVENACFSSEEHE      1 - 70
THFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVDYGFVSALVFLVSGILLVVTA     71 - 140
YAIPREARVNPDTVTAREMERLEMYYARLGSHLDRCIIAGLGLLTVGGMLLSVLLMVSLCKGELYRRRTF    141 - 210
VPGKGSRKTYGSINLRMRQLNGDGGQALVENEVVQVSETSHTLQRS                            211 - 256
//

Text Mined References (5)

PMID Year Title
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.