Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (1)

AA Sequence

MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYLLWVFTPLILLILPYFTIFLLYLTIIF      1 - 70
LHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGYEVHGMEKIPEDGPALIIFYHGAIPIDFYYF     71 - 140
MAKIFIHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEILRSGHLLAISPGGVREALISDETY    141 - 210
NIVWGHRRGFAQVAIDAKVPIIPMFTQNIREGFRSLGGTRLFRWLYEKFRYPFAPMYGGFPVKLRTYLGD    211 - 280
PIPYDPQITAEELAEKTKNAVQALIDKHQRIPGNIMSALLERFH                              281 - 324
//

Text Mined References (8)

PMID Year Title