Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.43
PubTator Score 1.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
osteosarcoma 1.880 1.2e-04
ependymoma -1.300 2.1e-04
glioblastoma -1.800 4.3e-05
group 4 medulloblastoma -2.500 2.2e-06
atypical teratoid / rhabdoid tumor -1.700 9.3e-06
medulloblastoma, large-cell -2.800 4.6e-04
primitive neuroectodermal tumor -1.200 3.5e-02
adrenocortical carcinoma 1.094 1.5e-02
tuberculosis and treatment for 3 months 1.300 4.3e-07
intraductal papillary-mucinous adenoma (... -1.800 2.8e-03
active Crohn's disease -1.098 6.3e-03
ulcerative colitis -1.800 6.4e-05
Breast cancer 2.600 4.7e-02
cystic fibrosis -1.200 1.3e-03
adult high grade glioma -2.000 1.1e-05
pilocytic astrocytoma -1.400 6.0e-05
invasive ductal carcinoma 1.300 1.4e-02
ovarian cancer 1.900 1.5e-04

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRLLPLLRSRTARSLRPGPAAAAAPRPPSWCCCGRGLLALAPPGGLPGGPRRLGTHPKKEPMEALNTAQ      1 - 70
GARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPTPGQLRYVFIHNAIPFIGFGFLDNAIMIVAG     71 - 140
THIEMSIGIILGISTMAAAALGNLVSDLAGLGLAGYVEALASRLGLSIPDLTPKQVDMWQTRLSTHLGKA    141 - 210
VGVTIGCILGMFPLIFFGGGEEDEKLETKS                                            211 - 240
//

Text Mined References (9)

PMID Year Title
26403541 2015 Evolutionarily conserved intercalated disc protein Tmem65 regulates cardiac conduction and connexin 43 function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24765583 2014 TMEM65 is a mitochondrial inner-membrane protein.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.