Property Summary

NCBI Gene PubMed Count 3
PubMed Score 11.18
PubTator Score 8.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma -1.900 1.7e-04
ependymoma -1.400 5.3e-08
group 3 medulloblastoma -2.300 1.8e-04
atypical teratoid / rhabdoid tumor -2.400 2.8e-08
medulloblastoma, large-cell -2.700 4.7e-07
primitive neuroectodermal tumor -1.400 4.6e-04
juvenile dermatomyositis -1.059 5.0e-11
adult high grade glioma -2.000 9.5e-05
subependymal giant cell astrocytoma -1.366 3.3e-02
lung carcinoma 1.400 7.8e-34

Synonym

Accession Q9UK28
Symbols BSMAP
C19orf4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAAVALMPPPLLLLLLLASPPAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDR      1 - 70
AVLISACERGCRLFSICRFVARSSKPNATQTECEAACVEAYVKEAEQQACSHGCWSQPAEPEPEQKRKVL     71 - 140
EAPSGALSLLDLFSTLCNDLVNSAQGFVSSTWTYYLQTDNGKVVVFQTQPIVESLGFQGGRLQRVEVTWR    141 - 210
GSHPEALEVHVDPVGPLDKVRKAKIRVKTSSKAKVESEEPQDNDFLSCMSRRSGLPRWILACCLFLSVLV    211 - 280
MLWLSCSTLVTAPGQHLKFQPLTLEQHKGFMMEPDWPLYPPPSHACEDSLPPYKLKLDLTKL            281 - 342
//

Text Mined References (4)

PMID Year Title
20427278 2010 The novel membrane protein TMEM59 modulates complex glycosylation, cell surface expression, and secretion of the amyloid precursor protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10527841 1999 BSMAP, a novel protein expressed specifically in the brain whose gene is localized on chromosome 19p12.