Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.71
PubTator Score 9.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.800 1.2e-03
oligodendroglioma -1.100 8.1e-03
ependymoma -1.200 1.2e-07
cystic fibrosis -1.573 1.1e-05
atypical teratoid / rhabdoid tumor -1.800 2.9e-06
glioblastoma -1.200 2.5e-04
medulloblastoma, large-cell -1.200 1.0e-03
tuberculosis and treatment for 6 months 1.100 4.3e-05
pancreatic ductal adenocarcinoma liver m... -1.619 1.6e-02
intraductal papillary-mucinous neoplasm ... 1.600 2.8e-03
Breast cancer 2.600 2.8e-02
lung adenocarcinoma -1.200 8.5e-09
ulcerative colitis -1.200 3.7e-03
ovarian cancer -1.900 9.1e-09

 GO Function (1)

Gene RIF (3)

PMID Text
22451312 The TMEM59 gene identified from our discovery approach was recently implicated in amyloid-beta protein precursor post-translational processing, supporting a role for epigenetic change in LOAD pathology.
20427278 TMEM59 affects amyloid precursor protein shedding by reducing its acccess to cellular components.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYAC      1 - 70
QRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHL     71 - 140
LFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSYL    141 - 210
QMRNSQAHRNFLEDGESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGDL    211 - 280
EFMNEQKLNRYPASSLVVVRSKTEDHEEAGPLPTKVNLAHSEI                               281 - 323
//

Text Mined References (19)

PMID Year Title
25663231 2015 PARK10 is a major locus for sporadic neuropathologically confirmed Parkinson disease.
24928548 2014 Gene expression analysis in MCF-7 breast cancer cells treated with recombinant bromelain.
24424470 2014 Overexpression of DCF1 inhibits glioma through destruction of mitochondria and activation of apoptosis pathway.
23376921 2013 TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3.
22482075 2012 Analyzing microarray data of Alzheimer's using cluster analysis to identify the biomarker genes.
22451312 2012 Genome-wide DNA methylation differences between late-onset Alzheimer's disease and cognitively normal controls in human frontal cortex.
22336716 2012 MicroRNA-351 regulates TMEM 59 (DCF1) expression and mediates neural stem cell morphogenesis.
20427278 2010 The novel membrane protein TMEM59 modulates complex glycosylation, cell surface expression, and secretion of the amyloid precursor protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.