Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.4e-08
tuberculosis 2010 1.6e-07
oligodendroglioma 2850 1.8e-02
group 3 medulloblastoma 4104 4.1e-02

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.100 4.1e-02
oligodendroglioma -1.100 1.8e-02
osteosarcoma -3.693 1.4e-08
tuberculosis -4.000 1.6e-07

Gene RIF (1)

AA Sequence

MGVRVHVVAASALLYFILLSGTRCEENCGNPEHCLTTDWVHLWYIWLLVVIGALLLLCGLTSLCFRCCCL      1 - 70
SRQQNGEDGGPPPCEVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHSHSSLGQLPSSLDTLPGYEE     71 - 140
ALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN                               141 - 183
//

Text Mined References (8)

PMID Year Title