Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.4e-08
tuberculosis 1563 1.6e-07
oligodendroglioma 2849 1.8e-02
group 3 medulloblastoma 2254 4.1e-02

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma -1.100 1.8e-02
osteosarcoma -3.693 1.4e-08
tuberculosis -4.000 1.6e-07
group 3 medulloblastoma -1.100 4.1e-02

Synonym

Accession Q4KMG9 Q96NA7
Symbols C12orf59

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGVRVHVVAASALLYFILLSGTRCEENCGNPEHCLTTDWVHLWYIWLLVVIGALLLLCGLTSLCFRCCCL      1 - 70
SRQQNGEDGGPPPCEVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHSHSSLGQLPSSLDTLPGYEE     71 - 140
ALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN                               141 - 183
//

Text Mined References (7)

PMID Year Title
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.