Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.55
PubTator Score 0.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1563 1.7e-05
invasive ductal carcinoma 2950 1.8e-04
interstitial cystitis 2299 2.6e-04
cystic fibrosis 1670 2.8e-04
group 4 medulloblastoma 1875 4.6e-03
Disease Target Count Z-score Confidence
Scoliosis 40 3.03 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis 1.241 2.8e-04
tuberculosis -1.600 1.7e-05
interstitial cystitis -1.100 2.6e-04
group 4 medulloblastoma -1.100 4.6e-03
invasive ductal carcinoma 1.200 1.8e-04

Synonym

Accession Q9NW97 A8K819
Symbols C1orf72

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLV      1 - 70
GAGVMLLLLSICLSIRDKRKQRQGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASRYYVPSYEEVMNT     71 - 140
NYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVEASPGNPPDRQNSKLAKRLKPLKVRRIKSEK    141 - 210
LHLKDFRINLPDKNVPPPSIEPLTPPPQYDEVQEKAPDTRPPD                               211 - 253
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.