Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.47
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.103 4.5e-03
ependymoma -1.100 3.1e-02
juvenile dermatomyositis 1.501 4.7e-13
acute quadriplegic myopathy 1.073 1.1e-05
primary pancreatic ductal adenocarcinoma 1.268 2.3e-03
lung cancer -1.300 3.4e-03
ovarian cancer 2.100 4.5e-04
pancreatic cancer 1.300 2.2e-03

AA Sequence

MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACGVIATIAFLMI      1 - 70
NAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFI     71 - 140
FFGGLVFKFGRTEDLWQ                                                         141 - 157
//

Text Mined References (16)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21700265 2011 Complement receptor 1 gene variants are associated with erythrocyte sedimentation rate.
16381901 2006 The LIFEdb database in 2006.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11902138 2002 RHCE represents the ancestral RH position, while RHD is the duplicated gene.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10938938 2000 Molecular genetics of RH.
10845894 2000 RHD gene deletion occurred in the Rhesus box.