Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.6e-07

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.500 1.6e-07

Synonym

Accession Q69YG0 Q8WUQ6
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFGALAAASAKLAFGSEVSMGLC      1 - 70
VLGIIVMASTNSLMWTFFSRGLSFSMSSAIASVTVTFSNILSSAFLGYVLYGECQEVLWWGGVFLILCGL     71 - 140
TLIHRKLPPTWKPLPHKQQ                                                       141 - 159
//

Text Mined References (4)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.