Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.56
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -1.400 2.1e-02
interstitial cystitis -1.100 9.2e-03
mucosa-associated lymphoid tissue lympho... 1.388 3.2e-02
nasopharyngeal carcinoma -1.300 7.6e-04
non-small cell lung cancer 1.664 5.2e-09
osteosarcoma -1.616 1.1e-02
pancreatic cancer 1.500 1.8e-03
pancreatic carcinoma 1.500 1.8e-03
psoriasis 1.300 3.0e-08
spina bifida -2.270 3.9e-02

AA Sequence

METSASSSQPQDNSQVHRETEDVDYGETDFHKQDGKAGLFSQEQYERNKSSSSSSSSSSSSSSSSSSSSS      1 - 70
ESNDEDQQPRATGKHRRSLGAGYPHGNGSPGPGHGEPDVLKDELQLYGDAPGEVVPSGESGLRRRGSDPA     71 - 140
SGEVEASQLRRLNIKKDDEFFHFVLLCFAIGALLVCYHYYADWFMSLGVGLLTFASLETVGIYFGLVYRI    141 - 210
HSVLQGFIPLFQKFRLTGFRKTD                                                   211 - 233
//

Text Mined References (7)

PMID Year Title