Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.66
PubTator Score 11.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.306 1.7e-02
oligodendroglioma 1.500 4.6e-03
osteosarcoma 3.307 2.2e-05
atypical teratoid / rhabdoid tumor -1.700 1.2e-04
glioblastoma 1.200 1.3e-02
medulloblastoma, large-cell -1.900 1.5e-06
acute quadriplegic myopathy 1.260 5.8e-04
hereditary spastic paraplegia -1.007 2.5e-02
juvenile dermatomyositis 1.315 9.7e-12
pancreatic ductal adenocarcinoma liver m... -1.508 1.4e-02
lung cancer -1.900 1.9e-05
active Crohn's disease 1.104 8.0e-03
diabetes mellitus -1.100 1.2e-03
Breast cancer 2.100 4.8e-02
pilocytic astrocytoma 1.100 1.2e-02
psoriasis 1.100 1.7e-03
Polycystic Ovary Syndrome -1.298 1.7e-02
Alzheimer's disease -1.500 3.3e-02
Pick disease -1.700 9.1e-05
progressive supranuclear palsy -1.700 8.9e-03
ovarian cancer 2.800 5.9e-05

Gene RIF (7)

PMID Text
25239307 Data indicate that the lipid flippase (ATP8B1)-transmembrane protein 30A (CDC50A) heterodimer is essential for the apical localization of sodium-dependent bile acid transporter (SLC10A2/ASBT) in Caco-2 cells.
24904167 ATP11C and CDC50A are required for aminophospholipid translocation from the outer to the inner plasma membrane leaflet; that is, they display flippase activity.
23269685 the phospholipid flippase complex of ATP8A1 and CDC50A proteins has a role in cell migration
21454556 CDC50A is the beta-subunit of ATP8A2 and is crucial for the correct folding, stable expression, export from endoplasmic reticulum, and phosphatidylserine flippase activity of ATP8A2
21289302 Import of choline phospholipids into Saccharomyces cerevisiae DeltaLem3 vector is partially reconstituted by human TMEM30a and by Lem3p-TMEM30a chimeras, showing that the proteins are orthologous.
20510206 CDC50A plays a key role in perifosine uptake in human cells, presumably by forming a functional plasma membrane translocator.
17948906 CDC50A may be the potential beta-subunit or chaperone for ATP8B1 in hepatocytes.

AA Sequence

MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFV      1 - 70
TSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDD     71 - 140
SQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDK    141 - 210
NVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKS    211 - 280
DLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKY    281 - 350
RNSSNTADITI                                                               351 - 361
//

Text Mined References (23)

PMID Year Title
25239307 2014 The lipid flippase heterodimer ATP8B1-CDC50A is essential for surface expression of the apical sodium-dependent bile acid transporter (SLC10A2/ASBT) in intestinal Caco-2 cells.
24904167 2014 Caspase-mediated cleavage of phospholipid flippase for apoptotic phosphatidylserine exposure.
23269685 2013 Role for phospholipid flippase complex of ATP8A1 and CDC50A proteins in cell migration.
21914794 2011 ATP9B, a P4-ATPase (a putative aminophospholipid translocase), localizes to the trans-Golgi network in a CDC50 protein-independent manner.
21454556 2011 Critical role of the beta-subunit CDC50A in the stable expression, assembly, subcellular localization, and lipid transport activity of the P4-ATPase ATP8A2.
21289302 2011 Human TMEM30a promotes uptake of antitumor and bioactive choline phospholipids into mammalian cells.
20961850 2010 CDC50 proteins are critical components of the human class-1 P4-ATPase transport machinery.
20947505 2010 Heteromeric interactions required for abundance and subcellular localization of human CDC50 proteins and class 1 P4-ATPases.
20510206 2010 CDC50A plays a key role in the uptake of the anticancer drug perifosine in human carcinoma cells.
19946888 2010 Defining the membrane proteome of NK cells.
19731236 2009 Differential effects of progressive familial intrahepatic cholestasis type 1 and benign recurrent intrahepatic cholestasis type 1 mutations on canalicular localization of ATP8B1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17948906 2008 ATP8B1 requires an accessory protein for endoplasmic reticulum exit and plasma membrane lipid flippase activity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375526 2004 Identification and characterization of CDC50A, CDC50B and CDC50C genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.