Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.07
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
chronic lymphocytic leukemia 1.190 5.3e-03
malignant mesothelioma 1.300 1.2e-06
astrocytic glioma -2.000 6.8e-03
ependymoma -2.100 1.2e-02
oligodendroglioma -1.600 2.7e-02
cutaneous lupus erythematosus 1.300 1.4e-03
glioblastoma -2.100 3.8e-04
osteosarcoma -1.457 4.1e-05
atypical teratoid / rhabdoid tumor -2.000 3.8e-06
medulloblastoma -1.700 3.7e-04
medulloblastoma, large-cell -1.800 9.0e-03
primitive neuroectodermal tumor -1.500 1.1e-02
active Crohn's disease 1.058 1.1e-02
adult high grade glioma -1.500 9.8e-03
pilocytic astrocytoma -1.400 9.9e-04
Pick disease -1.400 1.8e-02
pituitary cancer 1.200 3.2e-05

AA Sequence

MACEPQVDPGATGPLPPSSPGWSALPGGSPPGWGQELHNGQVLTVLRIDNTCAPISFDLGAAEEQLQTWG      1 - 70
IQVPADQYRSLAESALLEPQVRRYIIYNSRPMRLAFAVVFYVVVWANIYSTSQMFALGNHWAGMLLVTLA     71 - 140
AVSLTLTLVLVFERHQKKANTNTDLRLAAANGALLRHRVLLGVTDTVEGCQSVIQLWFVYFDLENCVQFL    141 - 210
SDHVQEMKTSQESLLRSRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEA    211 - 280
EPEEMARQLLAVFGGYYIRLLVTSQLPQAMGTRHTNSPRIPCPCQLIEAYILGTGCCPFLAR            281 - 342
//

Text Mined References (13)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.