Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 1.0e-04
aldosterone-producing adenoma 1.086 1.8e-02
Astrocytoma, Pilocytic -1.700 2.0e-08
atypical teratoid / rhabdoid tumor -1.300 1.5e-05
glioblastoma -1.600 5.0e-10
medulloblastoma -1.400 2.9e-06
medulloblastoma, large-cell -1.500 7.4e-04
primitive neuroectodermal tumor -1.600 8.5e-04
subependymal giant cell astrocytoma -2.427 2.3e-02

Gene RIF (2)

AA Sequence

MAVAPSFNMTNPQPAIEGGISEVEIISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTAGSQLLSNLDE      1 - 70
DYQREGSNWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELLIDIKLLQFSSAFQFAGVIHW     71 - 140
ISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILSLAPMVASTVANGPRSPWDAISLIIMLRIW    141 - 210
RVKRVIDAYVLPVKLEMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAA    211 - 280
LQAPHVLSQPRSRFKVLEAGTWDEETAAESVVEELQPSQEATMKDDMNSYISQYYNGPSSDSGVPEPAVC    281 - 350
MVTTAAIDIHQPNISSDLFSLDMPLKLGGNGTSATSESASRSSVTRAQSDSSQTLGSSMDCSTAREEPSS    351 - 420
EPGPSPPPLPSQQQVEEATVQDLLSSLSEDPCPSQKALDPAPLARPSPAGSAQTSPELEHRVSLFNQKNQ    421 - 490
EGFTVFQIRPVIHFQPTVPMLEDKFRSLESKEQKLHRVPEA                                 491 - 531
//

Text Mined References (8)

PMID Year Title