Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.64
PubTator Score 1.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 7.4e-06
group 3 medulloblastoma 1.800 1.3e-04
intraductal papillary-mucinous adenoma (... 1.100 1.2e-03
medulloblastoma, large-cell 1.600 2.4e-02
osteosarcoma 2.205 3.9e-09
ovarian cancer -1.200 1.8e-05
primitive neuroectodermal tumor 1.100 2.3e-03
Rheumatoid arthritis 1.700 3.9e-02

Gene RIF (2)

AA Sequence

MSPHGDGRGQAQGRAVRVGLRRSGGIRGGVAVFAAVAAVFTFTLPPSVPGGDSGELITAAHELGVAHPPG      1 - 70
YPLFTLVAKLAITLFPFGSIAYRVNLLCGLFGAVAASLLFFTVFRLSGSSAGGILAAGVFSFSRLTWQWS     71 - 140
IAAEVFSLNNLFVGLLMALTVHFEEAATAKERSKVAKIGAFCCGLSLCNQHTIILYVLCIIPWILFQLLK    141 - 210
KKELSLGSLLKLSLYFSAGLLPYVHLPISSYLNHARWTWGDQTTLQGFLTHFLREEYGTFSLAKSEIGSS    211 - 280
MSEILLSQVTNMRTELSFNIQALAVCANICLATKDRQNPSLVWLFTGMFCIYSLFFAWRANLDISKPLFM    281 - 350
GVVERFWMQSNAVVAVLAGIGLAAVVSETNRVLNSNGLQCLEWLSATLFVVYQIYSNYSVCDQRTNYVID    351 - 420
KFAKNLLTSMPHDAIILLRGDLPGNSLRYMHYCEGLRPDISLVDQEMMTYEWYLPKMAKHLPGVNFPGNR    421 - 490
WNPVEGILPSGMVTFNLYHFLEVNKQKETFVCIGIHEGDPTWKKNYSLWPWGSCDKLVPLEIVFNPEEWI    491 - 560
KLTKSIYNWTEEYGRFDPSSWESVANEEMWQARMKTPFFIFNLAETAHMPSKVKAQLYAQAYDLYKEIVY    561 - 630
LQKEHPVNWHKNYAIACERMLRLQARDADPEVLLSETIRHFRLYSQKAPNDPQQADILGALKHLRKELQS    631 - 700
LRNRKNV                                                                   701 - 707
//

Text Mined References (6)

PMID Year Title