Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.11
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 1.1e-07
psoriasis 6694 1.2e-05
osteosarcoma 7950 1.2e-04
tuberculosis 2010 1.2e-04
breast carcinoma 1638 2.5e-04
interstitial cystitis 2312 3.5e-04
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 30 3.844 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.400 2.5e-04
ependymoma 1.100 1.1e-07
interstitial cystitis -1.100 3.5e-04
osteosarcoma -1.557 1.2e-04
psoriasis -1.200 1.2e-05
tuberculosis 1.200 1.2e-04

Gene RIF (1)

AA Sequence

MATAAGATYFQRGSLFWFTVITLSFGYYTWVVFWPQSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWL      1 - 70
IHVGESLYAIVLCKHKGITSGRAQLLWFLQTFFFGIASLTILIAYKRKRQKQT                      71 - 123
//

Text Mined References (9)

PMID Year Title