Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.40
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 1.2e-04
atypical teratoid / rhabdoid tumor -1.300 2.6e-05
Breast cancer -1.500 8.3e-05
fibroadenoma 1.400 1.3e-03
glioblastoma -1.300 4.7e-04
group 4 medulloblastoma -1.100 5.1e-04
intraductal papillary-mucinous carcinoma... -1.100 1.0e-04
medulloblastoma, large-cell -1.600 1.4e-04
posterior fossa group B ependymoma -1.200 5.2e-09
subependymal giant cell astrocytoma -1.521 4.5e-02

 CSPA Cell Line (1)

Gene RIF (2)

AA Sequence

MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQ      1 - 70
LQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQ     71 - 140
EAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVA    141 - 210
TNDVGVTSASLPAPGLLATRVEVPLLGIVVAAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSD    211 - 280
SNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVL    281 - 350
GYIYRVSSVSSDEIWL                                                          351 - 366
//

Text Mined References (13)

PMID Year Title