Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Corneal disease 31 0.0 3.0

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.200 4.5e-02
ependymoma 1.300 2.2e-13
glioblastoma 1.200 8.9e-07
intraductal papillary-mucinous adenoma (... 1.100 7.1e-03
Multiple myeloma 1.845 6.7e-06
osteosarcoma 1.270 2.0e-04
ovarian cancer -1.900 3.9e-09
pediatric high grade glioma 1.400 7.6e-06
psoriasis 1.200 3.0e-03

 GWAS Trait (1)

AA Sequence

MFSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLLRFNDLDLCVS      1 - 70
ENETLKHLTNDTTTPESTMTSGQARASTQSPQALEDSGPVNISVSITLTLDPLKPFGGYSRNVTHLYSTI     71 - 140
LGHQIGLSGREAHEEINITFTLPTAWSSDDCALHGHCEQVVFTACMTLTASPGVFPVTVQPPHCVPDTYS    141 - 210
NATLWYKIFTTARDANTKYAQDYNPFWCYKGAIGKVYHALNPKLTVIVPDDDRSLINLHLMHTSYFLFVM    211 - 280
VITMFCYAVIKGRPSKLRQSNPEFCPEKVALAEA                                        281 - 314
//

Text Mined References (8)

PMID Year Title